Detailed information NTG0358440

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: GRI05_RS00770
• Genome accession: NZ_CP047248
• Coordinates: 122182..122589 (+)
• Length: 135 a.a.
• NCBI ID: WP_011921721.1
• Uniprot ID: A0A0H3MT39
• Organism: Streptococcus suis strain LSM178
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 117182..127589

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GRI05_RS00745 (GRI05_00775)	-	118590..118955 (+)	366	WP_002936568.1	DUF1033 family protein	-
GRI05_RS00750 (GRI05_00780)	-	118990..119933 (-)	944	Protein_115	S66 family peptidase	-
GRI05_RS00755 (GRI05_00785)	comGA	120019..120969 (+)	951	WP_011921718.1	competence type IV pilus ATPase ComGA	Machinery gene
GRI05_RS00760 (GRI05_00790)	comGB	120881..121918 (+)	1038	WP_011921719.1	competence type IV pilus assembly protein ComGB	Machinery gene
GRI05_RS00765 (GRI05_00795)	comGC	121920..122201 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
GRI05_RS00770 (GRI05_00800)	comGD	122182..122589 (+)	408	WP_011921721.1	competence type IV pilus minor pilin ComGD	Machinery gene
GRI05_RS00775 (GRI05_00805)	comGE	122561..122854 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
GRI05_RS00780 (GRI05_00810)	comGF/cglF	122841..123275 (+)	435	WP_011922561.1	competence type IV pilus minor pilin ComGF	Machinery gene
GRI05_RS00785 (GRI05_00815)	comGG	123253..123663 (+)	411	WP_011921724.1	competence type IV pilus minor pilin ComGG	Machinery gene
GRI05_RS00790 (GRI05_00820)	comGH	123720..124673 (+)	954	WP_011922562.1	class I SAM-dependent methyltransferase	Machinery gene
GRI05_RS00795 (GRI05_00825)	-	124723..125910 (+)	1188	WP_012775422.1	acetate kinase	-
GRI05_RS00800 (GRI05_00830)	-	126225..126776 (+)	552	WP_012774908.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 135 a.a.
• Molecular weight: 15367.59 Da
• Isoelectric Point: 8.3926

>NTDB_id=358440 GRI05_RS00770 WP_011921721.1 122182..122589(+) (comGD) [Streptococcus suis strain LSM178]
MLRRKNKAFTLFESLLTLLVVSFLAVSLSGTVQTVFRSVQEEIFLWEFEAIYKDSQKLAASSHKKVNLAIGGQEVTNGYQ
AVEVPRNVEVLEEKTIQFEEDGGNSSLTKIRFHLSQKIVTYQLYIGSGRYKKTEE

Nucleotide

• Length: 408 bp

>NTDB_id=358440 GRI05_RS00770 WP_011921721.1 122182..122589(+) (comGD) [Streptococcus suis strain LSM178]
ATGCTACGGCGAAAAAATAAGGCTTTTACCCTGTTTGAAAGCCTGCTGACCTTGTTGGTTGTCAGTTTTTTAGCTGTTTC
CTTATCAGGAACAGTACAAACGGTCTTTCGGTCTGTTCAGGAAGAAATTTTTCTCTGGGAATTTGAGGCCATCTATAAAG
ACAGTCAGAAATTAGCAGCCAGTTCCCACAAAAAAGTGAACCTTGCTATCGGTGGACAGGAGGTTACAAATGGTTATCAG
GCTGTAGAGGTGCCCAGAAACGTAGAGGTCTTAGAGGAGAAAACTATTCAGTTTGAAGAAGATGGTGGAAATTCTTCTCT
GACCAAGATTCGTTTTCACCTTAGTCAAAAAATAGTCACGTATCAATTATATATAGGGAGTGGTCGCTATAAGAAAACAG
AAGAATAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A0A0H3MT39

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Streptococcus gordonii str. Challis substr. CH1	48.031	94.074	0.452
comGD	Streptococcus mutans UA140	46.512	95.556	0.444
comGD	Streptococcus mutans UA159	46.512	95.556	0.444
comGD/cglD	Streptococcus pneumoniae TIGR4	44.961	95.556	0.43
comGD/cglD	Streptococcus pneumoniae R6	44.961	95.556	0.43
comGD/cglD	Streptococcus pneumoniae Rx1	44.961	95.556	0.43
comGD/cglD	Streptococcus pneumoniae D39	44.961	95.556	0.43
comGD/cglD	Streptococcus mitis NCTC 12261	44.186	95.556	0.422
comGD/cglD	Streptococcus mitis SK321	43.411	95.556	0.415
comGD	Lactococcus lactis subsp. cremoris KW2	39.062	94.815	0.37