Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   SB21_RS11875 Genome accession   NZ_CP039380
Coordinates   2437822..2438259 (-) Length   145 a.a.
NCBI ID   WP_007408322.1    Uniprot ID   -
Organism   Bacillus velezensis strain LPL-K103     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2432822..2443259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SB21_RS11825 (SB21_11825) sinI 2433206..2433379 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  SB21_RS11830 (SB21_11830) sinR 2433413..2433748 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SB21_RS11835 (SB21_11835) - 2433796..2434581 (-) 786 WP_007408329.1 TasA family protein -
  SB21_RS11840 (SB21_11840) - 2434646..2435230 (-) 585 WP_007408328.1 signal peptidase I -
  SB21_RS11845 (SB21_11845) tapA 2435202..2435873 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  SB21_RS11850 (SB21_11850) - 2436132..2436461 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  SB21_RS11855 (SB21_11855) - 2436501..2436680 (-) 180 WP_003153093.1 YqzE family protein -
  SB21_RS11860 (SB21_11860) comGG 2436737..2437114 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  SB21_RS11865 (SB21_11865) comGF 2437115..2437615 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  SB21_RS11870 (SB21_11870) comGE 2437524..2437838 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  SB21_RS11875 (SB21_11875) comGD 2437822..2438259 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  SB21_RS11880 (SB21_11880) comGC 2438249..2438557 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  SB21_RS11885 (SB21_11885) comGB 2438562..2439599 (-) 1038 WP_039063317.1 competence type IV pilus assembly protein ComGB Machinery gene
  SB21_RS11890 (SB21_11890) comGA 2439586..2440656 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  SB21_RS11895 (SB21_11895) - 2440848..2441798 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  SB21_RS11900 (SB21_11900) - 2441944..2443245 (+) 1302 WP_039063318.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16314.79 Da        Isoelectric Point: 10.2475

>NTDB_id=358348 SB21_RS11875 WP_007408322.1 2437822..2438259(-) (comGD) [Bacillus velezensis strain LPL-K103]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=358348 SB21_RS11875 WP_007408322.1 2437822..2438259(-) (comGD) [Bacillus velezensis strain LPL-K103]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment