Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | SB21_RS11825 | Genome accession | NZ_CP039380 |
| Coordinates | 2433206..2433379 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LPL-K103 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2428206..2438379
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SB21_RS11810 (SB21_11810) | gcvT | 2429019..2430119 (-) | 1101 | WP_039063314.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SB21_RS11815 (SB21_11815) | - | 2430543..2432213 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| SB21_RS11820 (SB21_11820) | - | 2432235..2433029 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| SB21_RS11825 (SB21_11825) | sinI | 2433206..2433379 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| SB21_RS11830 (SB21_11830) | sinR | 2433413..2433748 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| SB21_RS11835 (SB21_11835) | - | 2433796..2434581 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| SB21_RS11840 (SB21_11840) | - | 2434646..2435230 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| SB21_RS11845 (SB21_11845) | tapA | 2435202..2435873 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| SB21_RS11850 (SB21_11850) | - | 2436132..2436461 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| SB21_RS11855 (SB21_11855) | - | 2436501..2436680 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| SB21_RS11860 (SB21_11860) | comGG | 2436737..2437114 (-) | 378 | WP_039063315.1 | competence type IV pilus minor pilin ComGG | - |
| SB21_RS11865 (SB21_11865) | comGF | 2437115..2437615 (-) | 501 | WP_258038902.1 | competence type IV pilus minor pilin ComGF | - |
| SB21_RS11870 (SB21_11870) | comGE | 2437524..2437838 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| SB21_RS11875 (SB21_11875) | comGD | 2437822..2438259 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=358346 SB21_RS11825 WP_003153105.1 2433206..2433379(+) (sinI) [Bacillus velezensis strain LPL-K103]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=358346 SB21_RS11825 WP_003153105.1 2433206..2433379(+) (sinI) [Bacillus velezensis strain LPL-K103]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |