Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   E4T61_RS11900 Genome accession   NZ_CP039297
Coordinates   2467962..2468339 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis isolate UFLA258     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2462962..2473339
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E4T61_RS11860 (E4T61_11860) - 2463460..2464254 (+) 795 WP_136396493.1 YqhG family protein -
  E4T61_RS11865 (E4T61_11865) sinI 2464431..2464604 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  E4T61_RS11870 (E4T61_11870) sinR 2464638..2464973 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  E4T61_RS11875 (E4T61_11875) - 2465021..2465806 (-) 786 WP_007408329.1 TasA family protein -
  E4T61_RS11880 (E4T61_11880) - 2465871..2466443 (-) 573 WP_136396777.1 signal peptidase I -
  E4T61_RS11885 (E4T61_11885) tapA 2466427..2467098 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  E4T61_RS11890 (E4T61_11890) - 2467357..2467686 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  E4T61_RS11895 (E4T61_11895) - 2467726..2467905 (-) 180 WP_003153093.1 YqzE family protein -
  E4T61_RS11900 (E4T61_11900) comGG 2467962..2468339 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  E4T61_RS11905 (E4T61_11905) comGF 2468340..2468840 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  E4T61_RS11910 (E4T61_11910) comGE 2468749..2469063 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  E4T61_RS11915 (E4T61_11915) comGD 2469047..2469484 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  E4T61_RS11920 (E4T61_11920) comGC 2469474..2469740 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  E4T61_RS11925 (E4T61_11925) comGB 2469787..2470824 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  E4T61_RS11930 (E4T61_11930) comGA 2470811..2471881 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  E4T61_RS11935 (E4T61_11935) - 2472075..2473025 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=358019 E4T61_RS11900 WP_012117980.1 2467962..2468339(-) (comGG) [Bacillus velezensis isolate UFLA258]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=358019 E4T61_RS11900 WP_012117980.1 2467962..2468339(-) (comGG) [Bacillus velezensis isolate UFLA258]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment