Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | E4T61_RS11865 | Genome accession | NZ_CP039297 |
| Coordinates | 2464431..2464604 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis isolate UFLA258 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2459431..2469604
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4T61_RS11850 (E4T61_11850) | gcvT | 2460244..2461344 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| E4T61_RS11855 (E4T61_11855) | - | 2461768..2463438 (+) | 1671 | WP_025284995.1 | SNF2-related protein | - |
| E4T61_RS11860 (E4T61_11860) | - | 2463460..2464254 (+) | 795 | WP_136396493.1 | YqhG family protein | - |
| E4T61_RS11865 (E4T61_11865) | sinI | 2464431..2464604 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| E4T61_RS11870 (E4T61_11870) | sinR | 2464638..2464973 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| E4T61_RS11875 (E4T61_11875) | - | 2465021..2465806 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| E4T61_RS11880 (E4T61_11880) | - | 2465871..2466443 (-) | 573 | WP_136396777.1 | signal peptidase I | - |
| E4T61_RS11885 (E4T61_11885) | tapA | 2466427..2467098 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| E4T61_RS11890 (E4T61_11890) | - | 2467357..2467686 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| E4T61_RS11895 (E4T61_11895) | - | 2467726..2467905 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| E4T61_RS11900 (E4T61_11900) | comGG | 2467962..2468339 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| E4T61_RS11905 (E4T61_11905) | comGF | 2468340..2468840 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| E4T61_RS11910 (E4T61_11910) | comGE | 2468749..2469063 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| E4T61_RS11915 (E4T61_11915) | comGD | 2469047..2469484 (-) | 438 | WP_052827646.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=358017 E4T61_RS11865 WP_003153105.1 2464431..2464604(+) (sinI) [Bacillus velezensis isolate UFLA258]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=358017 E4T61_RS11865 WP_003153105.1 2464431..2464604(+) (sinI) [Bacillus velezensis isolate UFLA258]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |