Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   E4T61_RS11920 Genome accession   NZ_CP039297
Coordinates   2469474..2469740 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis isolate UFLA258     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2464474..2474740
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E4T61_RS11870 (E4T61_11870) sinR 2464638..2464973 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  E4T61_RS11875 (E4T61_11875) - 2465021..2465806 (-) 786 WP_007408329.1 TasA family protein -
  E4T61_RS11880 (E4T61_11880) - 2465871..2466443 (-) 573 WP_136396777.1 signal peptidase I -
  E4T61_RS11885 (E4T61_11885) tapA 2466427..2467098 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  E4T61_RS11890 (E4T61_11890) - 2467357..2467686 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  E4T61_RS11895 (E4T61_11895) - 2467726..2467905 (-) 180 WP_003153093.1 YqzE family protein -
  E4T61_RS11900 (E4T61_11900) comGG 2467962..2468339 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  E4T61_RS11905 (E4T61_11905) comGF 2468340..2468840 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  E4T61_RS11910 (E4T61_11910) comGE 2468749..2469063 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  E4T61_RS11915 (E4T61_11915) comGD 2469047..2469484 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  E4T61_RS11920 (E4T61_11920) comGC 2469474..2469740 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  E4T61_RS11925 (E4T61_11925) comGB 2469787..2470824 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  E4T61_RS11930 (E4T61_11930) comGA 2470811..2471881 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  E4T61_RS11935 (E4T61_11935) - 2472075..2473025 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  E4T61_RS11940 (E4T61_11940) - 2473171..2474472 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=358021 E4T61_RS11920 WP_042635730.1 2469474..2469740(-) (comGC) [Bacillus velezensis isolate UFLA258]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=358021 E4T61_RS11920 WP_042635730.1 2469474..2469740(-) (comGC) [Bacillus velezensis isolate UFLA258]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment