Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   E0L18_RS00930 Genome accession   NZ_CP037861
Coordinates   176146..176574 (+) Length   142 a.a.
NCBI ID   WP_016569994.1    Uniprot ID   -
Organism   Pasteurella multocida subsp. multocida strain HN01     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 134964..205109 176146..176574 within 0


Gene organization within MGE regions


Location: 134964..205109
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  E0L18_RS00680 (E0L18_00680) - 134964..135674 (+) 711 Protein_127 sialidase -
  E0L18_RS00685 (E0L18_00685) - 135896..136609 (+) 714 Protein_128 site-specific integrase -
  E0L18_RS12115 - 136938..137624 (-) 687 WP_255303073.1 KilA-N domain-containing protein -
  E0L18_RS00695 (E0L18_00695) - 137927..138763 (-) 837 WP_014390712.1 KilA-N domain-containing protein -
  E0L18_RS00700 (E0L18_00700) - 139189..139512 (-) 324 WP_139616918.1 hypothetical protein -
  E0L18_RS00705 (E0L18_00705) - 139560..145445 (-) 5886 WP_139616919.1 phage tail protein -
  E0L18_RS00710 (E0L18_00710) - 145449..146069 (-) 621 WP_102827074.1 tail assembly protein -
  E0L18_RS00715 (E0L18_00715) - 146012..146755 (-) 744 WP_139616920.1 C40 family peptidase -
  E0L18_RS00720 (E0L18_00720) - 146760..147464 (-) 705 WP_139616921.1 phage minor tail protein L -
  E0L18_RS00725 (E0L18_00725) - 147660..148796 (-) 1137 WP_139616922.1 RNA-guided endonuclease TnpB family protein -
  E0L18_RS00730 (E0L18_00730) tnpA 148843..149259 (+) 417 WP_005720092.1 IS200/IS605 family transposase -
  E0L18_RS00735 (E0L18_00735) - 149512..149862 (-) 351 WP_255303074.1 phage tail protein -
  E0L18_RS00740 (E0L18_00740) - 149859..152246 (-) 2388 WP_139616923.1 phage tail length tape measure family protein -
  E0L18_RS00745 (E0L18_00745) - 152233..152538 (-) 306 WP_368659735.1 phage tail assembly protein T -
  E0L18_RS00750 (E0L18_00750) - 152556..152945 (-) 390 WP_139616925.1 phage minor tail protein G -
  E0L18_RS00755 (E0L18_00755) - 152951..153457 (-) 507 WP_139616926.1 phage tail tube protein -
  E0L18_RS00760 (E0L18_00760) gpU 153454..153861 (-) 408 WP_115098330.1 phage tail terminator protein -
  E0L18_RS00765 (E0L18_00765) - 153858..154409 (-) 552 WP_139616927.1 phage tail protein -
  E0L18_RS00770 (E0L18_00770) - 154409..154702 (-) 294 WP_014391484.1 hypothetical protein -
  E0L18_RS00775 (E0L18_00775) - 154695..155021 (-) 327 WP_016570083.1 DUF2190 family protein -
  E0L18_RS00780 (E0L18_00780) - 155094..157100 (-) 2007 WP_139616928.1 ClpP-like prohead protease/major capsid protein fusion protein -
  E0L18_RS00785 (E0L18_00785) - 157036..158571 (-) 1536 WP_139616929.1 phage portal protein -
  E0L18_RS00790 (E0L18_00790) - 158568..158789 (-) 222 WP_139616930.1 hypothetical protein -
  E0L18_RS00795 (E0L18_00795) - 158786..160894 (-) 2109 WP_005719701.1 phage terminase large subunit family protein -
  E0L18_RS00800 (E0L18_00800) - 160897..161373 (-) 477 WP_139616931.1 DUF1441 family protein -
  E0L18_RS00805 (E0L18_00805) - 161653..161829 (+) 177 WP_016533221.1 type II toxin-antitoxin system HicA family toxin -
  E0L18_RS00810 (E0L18_00810) - 161877..162293 (+) 417 WP_016533220.1 type II toxin-antitoxin system HicB family antitoxin -
  E0L18_RS00820 (E0L18_00820) - 162518..162841 (-) 324 WP_014667795.1 DUF2570 family protein -
  E0L18_RS00825 (E0L18_00825) - 162814..163344 (-) 531 WP_014667794.1 lysozyme -
  E0L18_RS00830 (E0L18_00830) - 163341..163601 (-) 261 WP_014391475.1 holin -
  E0L18_RS00835 (E0L18_00835) - 163718..164275 (+) 558 WP_064964938.1 hypothetical protein -
  E0L18_RS00840 (E0L18_00840) - 164402..164767 (-) 366 WP_139616933.1 antiterminator Q family protein -
  E0L18_RS00845 (E0L18_00845) - 164767..165369 (-) 603 WP_139616934.1 recombination protein NinG -
  E0L18_RS00850 (E0L18_00850) - 165457..165669 (-) 213 WP_139616935.1 hypothetical protein -
  E0L18_RS00855 (E0L18_00855) - 165743..166168 (-) 426 WP_139616936.1 recombination protein NinB -
  E0L18_RS00860 (E0L18_00860) - 166171..166710 (-) 540 WP_139616937.1 MT-A70 family methyltransferase -
  E0L18_RS00865 (E0L18_00865) - 166707..168071 (-) 1365 WP_015691058.1 replicative DNA helicase -
  E0L18_RS00870 (E0L18_00870) - 168068..168886 (-) 819 WP_139616938.1 DNA replication protein -
  E0L18_RS12120 - 169289..169423 (-) 135 WP_016569987.1 hypothetical protein -
  E0L18_RS00880 (E0L18_00880) - 169490..169942 (-) 453 WP_139616939.1 phage regulatory CII family protein -
  E0L18_RS00885 (E0L18_00885) - 169992..170177 (-) 186 WP_139616940.1 Cro/CI family transcriptional regulator -
  E0L18_RS00890 (E0L18_00890) - 170305..171081 (+) 777 WP_071523582.1 XRE family transcriptional regulator -
  E0L18_RS00895 (E0L18_00895) - 171150..172055 (-) 906 WP_064964924.1 type VI secretion system-associated protein TagO -
  E0L18_RS12125 - 172278..172409 (+) 132 WP_255303076.1 hypothetical protein -
  E0L18_RS00900 (E0L18_00900) - 172784..173074 (+) 291 WP_139616941.1 hypothetical protein -
  E0L18_RS00905 (E0L18_00905) - 173211..173852 (+) 642 WP_139616942.1 DUF3560 domain-containing protein -
  E0L18_RS00910 (E0L18_00910) - 173896..174192 (+) 297 WP_139616943.1 hypothetical protein -
  E0L18_RS00915 (E0L18_00915) - 174164..174400 (+) 237 WP_075266289.1 hypothetical protein -
  E0L18_RS11910 - 174413..174574 (+) 162 WP_176558139.1 hypothetical protein -
  E0L18_RS11915 - 174577..174735 (+) 159 WP_176558141.1 hypothetical protein -
  E0L18_RS00920 (E0L18_00920) - 174747..175391 (+) 645 WP_139616944.1 ribonuclease H-like domain-containing protein -
  E0L18_RS00925 (E0L18_00925) - 175434..176135 (+) 702 WP_139616945.1 ERF family protein -
  E0L18_RS00930 (E0L18_00930) ssb 176146..176574 (+) 429 WP_016569994.1 single-stranded DNA-binding protein Machinery gene
  E0L18_RS00935 (E0L18_00935) - 176636..176989 (+) 354 WP_014391449.1 hypothetical protein -
  E0L18_RS00940 (E0L18_00940) - 177061..177849 (+) 789 WP_139616946.1 DUF2303 family protein -
  E0L18_RS00945 (E0L18_00945) - 178001..178588 (+) 588 WP_139616947.1 DUF551 domain-containing protein -
  E0L18_RS00950 (E0L18_00950) - 178847..179065 (+) 219 WP_005720317.1 hypothetical protein -
  E0L18_RS00955 (E0L18_00955) - 179079..179801 (+) 723 WP_005720319.1 phage antirepressor KilAC domain-containing protein -
  E0L18_RS12130 - 179858..180307 (+) 450 WP_255303077.1 pyruvate kinase -
  E0L18_RS00965 (E0L18_00965) - 180485..180697 (+) 213 WP_071522871.1 hypothetical protein -
  E0L18_RS00970 (E0L18_00970) - 180726..181034 (+) 309 WP_139616948.1 helix-turn-helix domain-containing protein -
  E0L18_RS00975 (E0L18_00975) - 180932..182023 (+) 1092 WP_139616949.1 site-specific integrase -
  E0L18_RS00985 (E0L18_00985) rne 182291..185311 (-) 3021 WP_139616950.1 ribonuclease E -
  E0L18_RS00990 (E0L18_00990) rluC 185728..186708 (+) 981 WP_139616951.1 23S rRNA pseudouridine(955/2504/2580) synthase RluC -
  E0L18_RS00995 (E0L18_00995) cobB 186786..187490 (+) 705 Protein_191 Sir2 family NAD+-dependent deacetylase -
  E0L18_RS01000 (E0L18_01000) trxA 187544..187867 (-) 324 WP_025248426.1 thioredoxin -
  E0L18_RS01005 (E0L18_01005) - 187979..189088 (-) 1110 WP_005717198.1 methionine biosynthesis PLP-dependent protein -
  E0L18_RS01025 (E0L18_01025) - 189749..190603 (+) 855 WP_139616952.1 ParA family protein -
  E0L18_RS01030 (E0L18_01030) dnaB 190604..191980 (+) 1377 WP_139616953.1 replicative DNA helicase -
  E0L18_RS12135 - 191992..192438 (+) 447 WP_255303078.1 ParB N-terminal domain-containing protein -
  E0L18_RS01035 (E0L18_01035) - 192375..193694 (+) 1320 WP_255303189.1 ParB family protein -
  E0L18_RS01040 (E0L18_01040) - 193714..194256 (+) 543 WP_139616954.1 DUF2857 domain-containing protein -
  E0L18_RS01045 (E0L18_01045) - 194344..194994 (+) 651 WP_139616955.1 STY4528 family pathogenicity island replication protein -
  E0L18_RS01050 (E0L18_01050) - 195080..195577 (+) 498 WP_139616956.1 hypothetical protein -
  E0L18_RS01055 (E0L18_01055) - 195769..196518 (+) 750 WP_139616957.1 PFL_4669 family integrating conjugative element protein -
  E0L18_RS01060 (E0L18_01060) - 196557..197054 (+) 498 WP_139616958.1 DUF3158 family protein -
  E0L18_RS01065 (E0L18_01065) ssb 197335..197742 (+) 408 WP_139616959.1 single-stranded DNA-binding protein Machinery gene
  E0L18_RS01070 (E0L18_01070) - 197760..198236 (+) 477 WP_139616960.1 hypothetical protein -
  E0L18_RS01075 (E0L18_01075) - 198784..199497 (-) 714 WP_139616961.1 AAA family ATPase -
  E0L18_RS01080 (E0L18_01080) - 199848..200813 (+) 966 WP_139616962.1 DUF6685 family protein -
  E0L18_RS01085 (E0L18_01085) - 200869..201231 (-) 363 WP_139616963.1 hypothetical protein -
  E0L18_RS01090 (E0L18_01090) - 201240..202622 (-) 1383 WP_368659736.1 integrating conjugative element protein -
  E0L18_RS12140 - 202562..203212 (-) 651 WP_255303081.1 hypothetical protein -
  E0L18_RS01095 (E0L18_01095) - 203218..204165 (-) 948 WP_139616964.1 TIGR03756 family integrating conjugative element protein -
  E0L18_RS01100 (E0L18_01100) - 204162..204599 (-) 438 WP_139616965.1 TIGR03757 family integrating conjugative element protein -
  E0L18_RS01105 (E0L18_01105) - 204849..205109 (+) 261 WP_139616966.1 antitoxin -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 15776.74 Da        Isoelectric Point: 8.0053

>NTDB_id=350248 E0L18_RS00930 WP_016569994.1 176146..176574(+) (ssb) [Pasteurella multocida subsp. multocida strain HN01]
MAGVNKVIIVGNLGQNPDYKVMTNGDPVTNISVATSEVWADKASGEKREVVEWHRITIYRRQADIAAQFLKKGSKVYVEG
RLKTRKWQDQSGQERYITEILADKIVLLDSKQSASAGNGSPPPAQQQHDPYGDAFNCDNIPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=350248 E0L18_RS00930 WP_016569994.1 176146..176574(+) (ssb) [Pasteurella multocida subsp. multocida strain HN01]
ATGGCTGGAGTAAATAAAGTAATTATTGTTGGCAACTTAGGGCAAAACCCCGATTACAAAGTAATGACAAATGGCGATCC
CGTGACCAACATCAGCGTGGCTACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAGCGCGAAGTTGTCGAGTGGC
ACCGTATTACGATATATCGCAGACAAGCGGACATTGCCGCACAATTTTTGAAAAAAGGTTCTAAAGTCTATGTTGAAGGT
CGTTTAAAAACTCGTAAATGGCAAGATCAAAGCGGACAAGAACGATACATCACAGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGAGTGCGAGTGCTGGCAATGGCAGTCCACCACCAGCACAACAGCAACATGATCCGTATGGTGACG
CATTTAATTGTGACAATATTCCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

67.544

80.282

0.542

  ssb Neisseria meningitidis MC58

42.958

100

0.43

  ssb Neisseria gonorrhoeae MS11

42.958

100

0.43

  ssb Vibrio cholerae strain A1552

59.596

69.718

0.415


Multiple sequence alignment