Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | IB64_RS11865 | Genome accession | NZ_CP037440 |
| Coordinates | 2815057..2815515 (+) | Length | 152 a.a. |
| NCBI ID | WP_005776338.1 | Uniprot ID | A0A4Q0U428 |
| Organism | Bacteroides fragilis strain DCMOUH0085B | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2776146..2831778 | 2815057..2815515 | within | 0 |
Gene organization within MGE regions
Location: 2776146..2831778
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB64_RS11665 (IB64_011665) | - | 2776146..2777135 (+) | 990 | WP_032539862.1 | lysylphosphatidylglycerol synthase transmembrane domain-containing protein | - |
| IB64_RS11670 (IB64_011670) | - | 2777654..2777983 (-) | 330 | Protein_2197 | AAA family ATPase | - |
| IB64_RS24195 (IB64_011675) | - | 2778267..2778478 (+) | 212 | Protein_2198 | transcriptional regulator | - |
| IB64_RS11680 (IB64_011680) | hsdR | 2778492..2780807 (+) | 2316 | WP_032539847.1 | EcoAI/FtnUII family type I restriction enzme subunit R | - |
| IB64_RS11685 (IB64_011685) | - | 2780810..2782330 (+) | 1521 | WP_032539848.1 | class I SAM-dependent DNA methyltransferase | - |
| IB64_RS11690 (IB64_011690) | - | 2782346..2783362 (+) | 1017 | WP_032529890.1 | hypothetical protein | - |
| IB64_RS11695 (IB64_011695) | - | 2783355..2783801 (+) | 447 | WP_010992489.1 | Fic family protein | - |
| IB64_RS11700 (IB64_011700) | - | 2783828..2784523 (+) | 696 | WP_254694695.1 | restriction endonuclease subunit S | - |
| IB64_RS11705 (IB64_011705) | - | 2784503..2785894 (-) | 1392 | WP_254694696.1 | restriction endonuclease subunit S | - |
| IB64_RS11710 (IB64_011710) | - | 2785953..2786759 (+) | 807 | WP_032536871.1 | tyrosine-type recombinase/integrase | - |
| IB64_RS11715 (IB64_011715) | - | 2787226..2788140 (-) | 915 | WP_032539850.1 | DUF4373 domain-containing protein | - |
| IB64_RS11720 (IB64_011720) | - | 2788292..2788639 (-) | 348 | WP_032539851.1 | SH3 beta-barrel fold-containing protein | - |
| IB64_RS11730 (IB64_011730) | upfY | 2789725..2790285 (+) | 561 | WP_080715543.1 | capsular polysaccharide transcription antiterminator UpfY | - |
| IB64_RS11735 (IB64_011735) | - | 2790297..2790779 (+) | 483 | WP_032539853.1 | UpxZ family transcription anti-terminator antagonist | - |
| IB64_RS11740 (IB64_011740) | rfbA | 2790812..2791705 (+) | 894 | WP_032539854.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| IB64_RS11745 (IB64_011745) | - | 2791695..2792099 (+) | 405 | WP_032539855.1 | FdtA/QdtA family cupin domain-containing protein | - |
| IB64_RS11750 (IB64_011750) | - | 2792096..2792512 (+) | 417 | WP_032539856.1 | FdtA/QdtA family cupin domain-containing protein | - |
| IB64_RS11755 (IB64_011755) | - | 2792505..2793026 (+) | 522 | WP_032539857.1 | acyltransferase | - |
| IB64_RS11760 (IB64_011760) | - | 2793031..2794128 (+) | 1098 | WP_032539858.1 | DegT/DnrJ/EryC1/StrS aminotransferase family protein | - |
| IB64_RS11765 (IB64_011765) | - | 2794133..2794552 (+) | 420 | WP_032539859.1 | adenylyltransferase/cytidyltransferase family protein | - |
| IB64_RS11770 (IB64_011770) | - | 2794542..2795543 (+) | 1002 | WP_137570017.1 | sulfotransferase | - |
| IB64_RS11775 (IB64_011775) | - | 2795533..2796963 (+) | 1431 | WP_137570018.1 | oligosaccharide flippase family protein | - |
| IB64_RS11780 (IB64_011780) | - | 2796960..2798195 (+) | 1236 | WP_032540034.1 | hypothetical protein | - |
| IB64_RS11785 (IB64_011785) | - | 2798192..2799301 (+) | 1110 | WP_032540035.1 | DegT/DnrJ/EryC1/StrS aminotransferase family protein | - |
| IB64_RS11790 (IB64_011790) | rfbF | 2799306..2800073 (+) | 768 | WP_032540037.1 | glucose-1-phosphate cytidylyltransferase | - |
| IB64_RS11795 (IB64_011795) | rfbG | 2800081..2801172 (+) | 1092 | WP_032540039.1 | CDP-glucose 4,6-dehydratase | - |
| IB64_RS11800 (IB64_011800) | - | 2801160..2801621 (+) | 462 | WP_032529214.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| IB64_RS11805 (IB64_011805) | - | 2801623..2802540 (+) | 918 | WP_050550243.1 | glycosyltransferase family 2 protein | - |
| IB64_RS11810 (IB64_011810) | - | 2802542..2803711 (+) | 1170 | WP_032540040.1 | O-antigen polymerase | - |
| IB64_RS11815 (IB64_011815) | - | 2803720..2804742 (+) | 1023 | WP_032540045.1 | polysaccharide biosynthesis protein | - |
| IB64_RS11820 (IB64_011820) | wecB | 2804730..2805860 (+) | 1131 | WP_137570019.1 | non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase | - |
| IB64_RS11825 (IB64_011825) | - | 2805881..2806738 (+) | 858 | WP_137570020.1 | SDR family oxidoreductase | - |
| IB64_RS11830 (IB64_011830) | - | 2806750..2807949 (+) | 1200 | WP_032540021.1 | glycosyltransferase family 4 protein | - |
| IB64_RS11835 (IB64_011835) | - | 2807956..2808852 (+) | 897 | WP_032540020.1 | NAD(P)-dependent oxidoreductase | - |
| IB64_RS11840 (IB64_011840) | - | 2808971..2809918 (+) | 948 | WP_032540018.1 | glycosyltransferase family 4 protein | - |
| IB64_RS11845 (IB64_011845) | - | 2809977..2811551 (-) | 1575 | WP_032531836.1 | Rne/Rng family ribonuclease | - |
| IB64_RS11850 (IB64_011850) | - | 2811831..2812106 (-) | 276 | WP_005776335.1 | HU family DNA-binding protein | - |
| IB64_RS11855 (IB64_011855) | mutY | 2812311..2813357 (+) | 1047 | WP_032540017.1 | A/G-specific adenine glycosylase | - |
| IB64_RS11860 (IB64_011860) | - | 2813401..2814969 (+) | 1569 | WP_032540016.1 | arylsulfatase | - |
| IB64_RS11865 (IB64_011865) | ssb | 2815057..2815515 (+) | 459 | WP_005776338.1 | single-stranded DNA-binding protein | Machinery gene |
| IB64_RS11870 (IB64_011870) | - | 2815651..2816997 (+) | 1347 | WP_022013013.1 | gliding motility-associated protein GldE | - |
| IB64_RS11875 (IB64_011875) | - | 2817005..2817655 (+) | 651 | WP_032536358.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
| IB64_RS23910 | - | 2817676..2819982 (+) | 2307 | WP_032540023.1 | hypothetical protein | - |
| IB64_RS11885 (IB64_011885) | - | 2820065..2820280 (-) | 216 | WP_005776344.1 | (4Fe-4S)-binding protein | - |
| IB64_RS11890 (IB64_011890) | - | 2820294..2820596 (-) | 303 | WP_032540015.1 | GNAT family N-acetyltransferase | - |
| IB64_RS11895 (IB64_011895) | - | 2820883..2821746 (+) | 864 | WP_032540014.1 | FimB/Mfa2 family fimbrial subunit | - |
| IB64_RS11900 (IB64_011900) | - | 2821790..2822875 (+) | 1086 | WP_032536338.1 | FimB/Mfa2 family fimbrial subunit | - |
| IB64_RS11905 (IB64_011905) | - | 2822902..2823933 (+) | 1032 | WP_032540013.1 | hypothetical protein | - |
| IB64_RS11910 (IB64_011910) | - | 2823959..2825497 (+) | 1539 | WP_032540012.1 | FimB/Mfa2 family fimbrial subunit | - |
| IB64_RS11915 (IB64_011915) | - | 2825651..2827111 (-) | 1461 | WP_032540011.1 | MAC/perforin domain-containing protein | - |
| IB64_RS11920 (IB64_011920) | - | 2827178..2828542 (-) | 1365 | WP_032540010.1 | DUF5074 domain-containing protein | - |
| IB64_RS11925 (IB64_011925) | - | 2828591..2829571 (-) | 981 | WP_005794072.1 | IS30-like element IS4351 family transposase | - |
| IB64_RS11930 (IB64_011930) | - | 2829721..2831778 (-) | 2058 | WP_032539809.1 | DUF5074 domain-containing protein | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 16725.68 Da Isoelectric Point: 5.7512
>NTDB_id=349757 IB64_RS11865 WP_005776338.1 2815057..2815515(+) (ssb) [Bacteroides fragilis strain DCMOUH0085B]
MSVNKVILIGNVGKDPEVRYLDTGIAVASFPLATTDRAYTLSNGTQVPERTEWHNLVLWRGLAETAEKYVHKGDKLYVEG
KIRTRSYDDQSGAKRYVTEIFVDNMEMLTPKGAGAGSYAPSQQQAAAPVRPQPQQPQQSASSQDNPADDLPF
MSVNKVILIGNVGKDPEVRYLDTGIAVASFPLATTDRAYTLSNGTQVPERTEWHNLVLWRGLAETAEKYVHKGDKLYVEG
KIRTRSYDDQSGAKRYVTEIFVDNMEMLTPKGAGAGSYAPSQQQAAAPVRPQPQQPQQSASSQDNPADDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=349757 IB64_RS11865 WP_005776338.1 2815057..2815515(+) (ssb) [Bacteroides fragilis strain DCMOUH0085B]
ATGTCAGTAAATAAAGTGATATTGATAGGAAATGTCGGTAAAGACCCTGAAGTGAGATATTTGGATACGGGTATTGCTGT
GGCCAGTTTTCCTTTGGCTACAACCGACCGTGCATATACTTTGTCTAATGGTACACAAGTGCCTGAGCGGACTGAATGGC
ACAATCTTGTACTTTGGCGAGGACTGGCAGAAACTGCCGAGAAATATGTACATAAAGGTGATAAGCTCTATGTGGAAGGT
AAGATAAGAACTCGTTCTTATGATGACCAGAGTGGGGCAAAACGCTATGTTACCGAGATATTTGTAGATAATATGGAAAT
GCTGACTCCGAAAGGTGCCGGTGCCGGATCGTATGCTCCGTCACAGCAGCAGGCTGCTGCTCCCGTACGGCCTCAACCGC
AACAACCGCAGCAATCGGCATCTTCACAAGATAATCCGGCAGACGATCTGCCGTTTTAA
ATGTCAGTAAATAAAGTGATATTGATAGGAAATGTCGGTAAAGACCCTGAAGTGAGATATTTGGATACGGGTATTGCTGT
GGCCAGTTTTCCTTTGGCTACAACCGACCGTGCATATACTTTGTCTAATGGTACACAAGTGCCTGAGCGGACTGAATGGC
ACAATCTTGTACTTTGGCGAGGACTGGCAGAAACTGCCGAGAAATATGTACATAAAGGTGATAAGCTCTATGTGGAAGGT
AAGATAAGAACTCGTTCTTATGATGACCAGAGTGGGGCAAAACGCTATGTTACCGAGATATTTGTAGATAATATGGAAAT
GCTGACTCCGAAAGGTGCCGGTGCCGGATCGTATGCTCCGTCACAGCAGCAGGCTGCTGCTCCCGTACGGCCTCAACCGC
AACAACCGCAGCAATCGGCATCTTCACAAGATAATCCGGCAGACGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.573 |
100 |
0.487 |
| ssb | Neisseria meningitidis MC58 |
39.205 |
100 |
0.454 |
| ssb | Neisseria gonorrhoeae MS11 |
39.205 |
100 |
0.454 |
| ssb | Glaesserella parasuis strain SC1401 |
37.079 |
100 |
0.434 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
32.37 |
100 |
0.368 |