Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HELPY_RS00215 Genome accession   NC_012973
Coordinates   37335..37448 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori B38     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32335..42448
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HELPY_RS00190 (HELPY_0031) - 32379..34604 (+) 2226 WP_001051516.1 AAA family ATPase -
  HELPY_RS00195 (HELPY_0032) panD 34594..34947 (+) 354 WP_000142262.1 aspartate 1-decarboxylase -
  HELPY_RS00200 (HELPY_0033) - 34950..35252 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HELPY_RS00205 (HELPY_0034) - 35252..36256 (+) 1005 WP_000468457.1 PDZ domain-containing protein -
  HELPY_RS00210 (HELPY_0035) comB6 36264..37319 (+) 1056 WP_000786644.1 P-type conjugative transfer protein TrbL Machinery gene
  HELPY_RS00215 comB7 37335..37448 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HELPY_RS00220 (HELPY_0036) comB8 37445..38188 (+) 744 WP_001208405.1 type IV secretion system protein Machinery gene
  HELPY_RS00225 (HELPY_0037) comB9 38188..39177 (+) 990 WP_012777816.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HELPY_RS00230 (HELPY_0038) comB10 39170..40300 (+) 1131 WP_001045895.1 DNA type IV secretion system protein ComB10 Machinery gene
  HELPY_RS00235 (HELPY_0039) - 40371..41783 (+) 1413 WP_000694863.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=34835 HELPY_RS00215 WP_001217873.1 37335..37448(+) (comB7) [Helicobacter pylori B38]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=34835 HELPY_RS00215 WP_001217873.1 37335..37448(+) (comB7) [Helicobacter pylori B38]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment