Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   EWG56_RS11965 Genome accession   NZ_CP035671
Coordinates   2358871..2359341 (+) Length   156 a.a.
NCBI ID   WP_000610650.1    Uniprot ID   -
Organism   Staphylococcus aureus strain VB31683     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2333834..2387824 2358871..2359341 within 0


Gene organization within MGE regions


Location: 2333834..2387824
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EWG56_RS11795 (EWG56_11795) groES 2333834..2334118 (+) 285 WP_000917289.1 co-chaperone GroES -
  EWG56_RS11800 (EWG56_11800) groL 2334194..2335810 (+) 1617 WP_000240649.1 chaperonin GroEL -
  EWG56_RS11805 (EWG56_11805) - 2335905..2336451 (-) 547 Protein_2243 site-specific integrase -
  EWG56_RS11810 (EWG56_11810) - 2336512..2336724 (+) 213 WP_000128898.1 hypothetical protein -
  EWG56_RS11815 (EWG56_11815) - 2336721..2337311 (+) 591 WP_001293059.1 terminase small subunit -
  EWG56_RS11820 (EWG56_11820) - 2337628..2338065 (+) 438 WP_072419900.1 hypothetical protein -
  EWG56_RS11825 (EWG56_11825) - 2338171..2338614 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  EWG56_RS11835 (EWG56_11835) - 2339457..2340764 (-) 1308 WP_001045063.1 TrkH family potassium uptake protein -
  EWG56_RS11840 (EWG56_11840) - 2340925..2341836 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  EWG56_RS11845 (EWG56_11845) - 2341898..2342743 (+) 846 WP_000812008.1 class I SAM-dependent methyltransferase -
  EWG56_RS11850 (EWG56_11850) - 2343115..2344338 (-) 1224 WP_000206641.1 ArgE/DapE family deacylase -
  EWG56_RS11855 (EWG56_11855) lukH 2344773..2345825 (+) 1053 WP_000791416.1 bi-component leukocidin LukGH subunit H -
  EWG56_RS11860 (EWG56_11860) lukG 2345847..2346863 (+) 1017 WP_000595402.1 bi-component leukocidin LukGH subunit G -
  EWG56_RS11865 (EWG56_11865) sph 2347101..2347931 (-) 831 Protein_2254 sphingomyelin phosphodiesterase -
  EWG56_RS11870 (EWG56_11870) - 2347982..2349019 (-) 1038 WP_000857176.1 site-specific integrase -
  EWG56_RS11875 (EWG56_11875) - 2349127..2349743 (+) 617 Protein_2256 ATPase -
  EWG56_RS11880 (EWG56_11880) - 2349740..2349886 (-) 147 WP_001013104.1 hypothetical protein -
  EWG56_RS11885 (EWG56_11885) - 2349922..2350104 (-) 183 WP_000694772.1 hypothetical protein -
  EWG56_RS11890 (EWG56_11890) - 2350304..2351074 (-) 771 WP_001208482.1 S24 family peptidase -
  EWG56_RS11895 (EWG56_11895) - 2351233..2351457 (+) 225 WP_000338186.1 DUF739 family protein -
  EWG56_RS11900 (EWG56_11900) - 2351475..2351735 (+) 261 WP_000435341.1 transcriptional regulator -
  EWG56_RS11905 (EWG56_11905) - 2351759..2352296 (-) 538 Protein_2262 hypothetical protein -
  EWG56_RS11910 (EWG56_11910) - 2352353..2353105 (+) 753 WP_024928163.1 phage antirepressor KilAC domain-containing protein -
  EWG56_RS11915 (EWG56_11915) - 2353121..2353318 (+) 198 Protein_2264 hypothetical protein -
  EWG56_RS11920 (EWG56_11920) - 2353349..2353489 (+) 141 WP_000939496.1 hypothetical protein -
  EWG56_RS11925 (EWG56_11925) - 2353504..2354136 (-) 633 WP_000275058.1 hypothetical protein -
  EWG56_RS11930 (EWG56_11930) - 2354195..2354515 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  EWG56_RS11935 (EWG56_11935) - 2354512..2354673 (+) 162 WP_070149316.1 DUF1270 family protein -
  EWG56_RS11940 (EWG56_11940) - 2354766..2355026 (+) 261 WP_000291488.1 DUF1108 family protein -
  EWG56_RS11945 (EWG56_11945) - 2355035..2355298 (+) 264 WP_001205732.1 hypothetical protein -
  EWG56_RS11950 (EWG56_11950) - 2355307..2357250 (+) 1944 WP_000700560.1 AAA family ATPase -
  EWG56_RS11955 (EWG56_11955) - 2357252..2358172 (+) 921 WP_000138475.1 recombinase RecT -
  EWG56_RS11960 (EWG56_11960) - 2358253..2358870 (+) 618 WP_073394849.1 MBL fold metallo-hydrolase -
  EWG56_RS11965 (EWG56_11965) ssbA 2358871..2359341 (+) 471 WP_000610650.1 single-stranded DNA-binding protein Machinery gene
  EWG56_RS11970 (EWG56_11970) - 2359371..2360264 (+) 894 WP_000148326.1 DnaD domain-containing protein -
  EWG56_RS11975 (EWG56_11975) - 2360271..2360489 (+) 219 WP_000338530.1 hypothetical protein -
  EWG56_RS11980 (EWG56_11980) - 2360498..2360902 (+) 405 WP_000401976.1 RusA family crossover junction endodeoxyribonuclease -
  EWG56_RS11985 (EWG56_11985) - 2360915..2361286 (+) 372 WP_000101268.1 SA1788 family PVL leukocidin-associated protein -
  EWG56_RS11990 (EWG56_11990) - 2361287..2361535 (+) 249 WP_001126836.1 phi PVL orf 51-like protein -
  EWG56_RS11995 (EWG56_11995) - 2361600..2362049 (+) 450 WP_000982708.1 YopX family protein -
  EWG56_RS12000 (EWG56_12000) - 2362046..2362330 (+) 285 WP_001105620.1 hypothetical protein -
  EWG56_RS12005 (EWG56_12005) - 2362323..2362577 (+) 255 WP_000370292.1 DUF1024 family protein -
  EWG56_RS12010 (EWG56_12010) - 2362697..2362897 (+) 201 WP_000265042.1 DUF1514 family protein -
  EWG56_RS12015 (EWG56_12015) - 2362925..2363341 (+) 417 WP_000590122.1 hypothetical protein -
  EWG56_RS12020 (EWG56_12020) - 2363573..2363872 (+) 300 WP_000988332.1 HNH endonuclease -
  EWG56_RS12025 (EWG56_12025) - 2364003..2364347 (+) 345 WP_000402904.1 hypothetical protein -
  EWG56_RS12030 (EWG56_12030) - 2364344..2366004 (+) 1661 Protein_2287 terminase large subunit -
  EWG56_RS12035 (EWG56_12035) - 2366020..2367207 (+) 1188 WP_000025274.1 phage portal protein -
  EWG56_RS12040 (EWG56_12040) - 2367191..2367928 (+) 738 WP_000642728.1 head maturation protease, ClpP-related -
  EWG56_RS12045 (EWG56_12045) - 2367952..2369097 (+) 1146 WP_000154555.1 phage major capsid protein -
  EWG56_RS12050 (EWG56_12050) - 2369117..2369401 (+) 285 WP_000238236.1 hypothetical protein -
  EWG56_RS12055 (EWG56_12055) - 2369391..2369675 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  EWG56_RS12060 (EWG56_12060) - 2369659..2370021 (+) 363 WP_000755150.1 head-tail adaptor protein -
  EWG56_RS12065 (EWG56_12065) - 2370018..2370422 (+) 405 WP_000114225.1 HK97 gp10 family phage protein -
  EWG56_RS12070 (EWG56_12070) - 2370419..2370826 (+) 408 WP_000565498.1 hypothetical protein -
  EWG56_RS12075 (EWG56_12075) - 2370827..2371471 (+) 645 WP_000268739.1 major tail protein -
  EWG56_RS12080 (EWG56_12080) - 2371525..2371737 (+) 213 WP_078101489.1 Ig-like domain-containing protein -
  EWG56_RS12085 (EWG56_12085) - 2371787..2372137 (+) 351 WP_001096355.1 hypothetical protein -
  EWG56_RS15035 - 2372191..2372325 (+) 135 WP_000364140.1 hypothetical protein -
  EWG56_RS12090 (EWG56_12090) - 2372382..2376911 (+) 4530 WP_001805631.1 phage tail tape measure protein -
  EWG56_RS12095 (EWG56_12095) - 2376908..2378392 (+) 1485 WP_000567408.1 phage tail domain-containing protein -
  EWG56_RS12100 (EWG56_12100) - 2378408..2382192 (+) 3785 Protein_2302 phage tail spike protein -
  EWG56_RS12105 (EWG56_12105) - 2382182..2382334 (+) 153 WP_001153681.1 hypothetical protein -
  EWG56_RS12110 (EWG56_12110) - 2382381..2382668 (+) 288 WP_001040261.1 hypothetical protein -
  EWG56_RS12115 (EWG56_12115) - 2382726..2383022 (+) 297 WP_000539688.1 DUF2951 domain-containing protein -
  EWG56_RS12120 (EWG56_12120) pepG1 2383216..2383350 (+) 135 WP_000880504.1 type I toxin-antitoxin system toxin PepG1 -
  EWG56_RS12125 (EWG56_12125) - 2383403..2383510 (-) 108 WP_031762631.1 hypothetical protein -
  EWG56_RS12130 (EWG56_12130) - 2383562..2383816 (+) 255 WP_000611512.1 phage holin -
  EWG56_RS12135 (EWG56_12135) - 2383828..2384583 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  EWG56_RS12140 (EWG56_12140) sak 2384774..2385265 (+) 492 WP_000920041.1 staphylokinase -
  EWG56_RS12160 (EWG56_12160) - 2385916..2386250 (+) 335 Protein_2311 SH3 domain-containing protein -
  EWG56_RS12165 (EWG56_12165) - 2386343..2386792 (-) 450 WP_000727643.1 chemotaxis-inhibiting protein CHIPS -
  EWG56_RS12170 (EWG56_12170) scn 2387474..2387824 (+) 351 WP_000702262.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17658.50 Da        Isoelectric Point: 4.9628

>NTDB_id=343486 EWG56_RS11965 WP_000610650.1 2358871..2359341(+) (ssbA) [Staphylococcus aureus strain VB31683]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=343486 EWG56_RS11965 WP_000610650.1 2358871..2359341(+) (ssbA) [Staphylococcus aureus strain VB31683]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAATCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.564

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment