Detailed information NTG0339172

Bioinformatically predicted

Overview

• Name: comYF
• Type: Machinery gene
• Locus tag: ESP48_RS04330
• Genome accession: NZ_CP035306
• Coordinates: 816050..816487 (-)
• Length: 145 a.a.
• NCBI ID: WP_011681686.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain IDCC2201
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 811050..821487

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ESP48_RS04290 (ESP48_04290)	-	811113..811775 (-)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-
ESP48_RS04295 (ESP48_04295)	-	811872..812315 (-)	444	WP_011681680.1	hypothetical protein	-
ESP48_RS10105 (ESP48_04300)	-	812389..812814 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
ESP48_RS10110 (ESP48_04305)	-	812771..813046 (-)	276	WP_011681681.1	hypothetical protein	-
ESP48_RS04310 (ESP48_04310)	-	813058..813256 (-)	199	Protein_823	helix-turn-helix transcriptional regulator	-
ESP48_RS04315 (ESP48_04315)	-	813505..814698 (-)	1194	WP_014608740.1	acetate kinase	-
ESP48_RS04320 (ESP48_04320)	comYH	814754..815710 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
ESP48_RS04325 (ESP48_04325)	comGG	815755..816072 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
ESP48_RS04330 (ESP48_04330)	comYF	816050..816487 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
ESP48_RS04335 (ESP48_04335)	comGE	816471..816764 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
ESP48_RS04340 (ESP48_04340)	comYD	816736..817164 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
ESP48_RS04345 (ESP48_04345)	comYC	817124..817450 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
ESP48_RS04350 (ESP48_04350)	comYB	817447..818547 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
ESP48_RS04355 (ESP48_04355)	comGA/cglA/cilD	818429..819370 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
ESP48_RS04360 (ESP48_04360)	-	819451..819813 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16375.85 Da
• Isoelectric Point: 8.4500

>NTDB_id=339172 ESP48_RS04330 WP_011681686.1 816050..816487(-) (comYF) [Streptococcus thermophilus strain IDCC2201]
MYLSSKLRAFTLLECLVALLVIAGSVQVYQGLTTVLVSNVKQVRQQENQDWLLFVQQMEAELEGCQLVKVEGNKLYVKQD
NQDLAFGLSSASDFRKTNADGRGYQPMLFDVKSSKVSQKNQIVTIQVTLKNELQRSFVYAFEKTG

Nucleotide

• Length: 438 bp

>NTDB_id=339172 ESP48_RS04330 WP_011681686.1 816050..816487(-) (comYF) [Streptococcus thermophilus strain IDCC2201]
ATGTATCTAAGCAGTAAGCTGCGTGCCTTTACCCTCTTGGAATGTCTAGTGGCCTTGTTGGTCATTGCTGGCTCAGTTCA
AGTTTATCAAGGGTTAACCACTGTACTTGTGAGTAATGTTAAGCAGGTAAGACAACAAGAAAACCAAGATTGGCTTCTAT
TTGTTCAACAAATGGAGGCAGAATTAGAAGGATGTCAGTTGGTCAAGGTAGAGGGGAACAAACTCTATGTCAAGCAGGAT
AATCAAGACTTGGCTTTTGGTCTTTCAAGTGCCTCTGATTTTCGAAAAACAAATGCTGATGGTCGAGGTTATCAACCAAT
GCTTTTCGATGTCAAATCTAGTAAGGTAAGTCAAAAGAACCAGATAGTTACCATCCAAGTGACTCTTAAAAATGAACTAC
AAAGGAGTTTTGTTTATGCTTTTGAAAAAACAGGTTAG

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (39-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYF	Streptococcus mutans UA140	58.156	97.241	0.566
comYF	Streptococcus mutans UA159	57.447	97.241	0.559
comGF/cglF	Streptococcus pneumoniae D39	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae Rx1	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae R6	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae TIGR4	49.286	96.552	0.476
comGF/cglF	Streptococcus mitis NCTC 12261	47.518	97.241	0.462
comGF/cglF	Streptococcus mitis SK321	46.809	97.241	0.455
comGF	Lactococcus lactis subsp. cremoris KW2	45.324	95.862	0.434