Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | EQH16_RS00110 | Genome accession | NZ_CP035264 |
| Coordinates | 21539..21775 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939544.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1901921 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..69416 | 21539..21775 | within | 0 |
| IS/Tn | 21016..21222 | 21539..21775 | flank | 317 |
Gene organization within MGE regions
Location: 12174..69416
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH16_RS00060 (EQH16_00060) | ftsH | 12174..14132 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| EQH16_RS00065 (EQH16_00065) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| EQH16_RS00100 (EQH16_00105) | - | 20274..20483 (+) | 210 | Protein_14 | transposase | - |
| EQH16_RS00105 (EQH16_00110) | - | 20518..21273 (-) | 756 | Protein_15 | transposase | - |
| EQH16_RS00110 (EQH16_00115) | comW | 21539..21775 (+) | 237 | WP_000939544.1 | sigma(X)-activator ComW | Regulator |
| EQH16_RS00115 (EQH16_00120) | - | 22006..23292 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| EQH16_RS00120 (EQH16_00125) | - | 23534..24682 (-) | 1149 | WP_000876722.1 | site-specific integrase | - |
| EQH16_RS00125 (EQH16_00130) | - | 25053..25460 (-) | 408 | WP_001173135.1 | DUF4429 domain-containing protein | - |
| EQH16_RS00130 (EQH16_00135) | - | 25505..25888 (-) | 384 | WP_000136458.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EQH16_RS00135 (EQH16_00140) | - | 25901..26266 (-) | 366 | WP_000477680.1 | helix-turn-helix domain-containing protein | - |
| EQH16_RS00140 (EQH16_00145) | - | 26553..26762 (+) | 210 | WP_000082680.1 | helix-turn-helix transcriptional regulator | - |
| EQH16_RS00145 (EQH16_00150) | - | 26766..27476 (+) | 711 | WP_061751222.1 | ORF6C domain-containing protein | - |
| EQH16_RS00150 (EQH16_00155) | - | 27489..27746 (+) | 258 | WP_000370958.1 | hypothetical protein | - |
| EQH16_RS00155 (EQH16_00160) | - | 27832..28152 (+) | 321 | WP_061643483.1 | hypothetical protein | - |
| EQH16_RS00160 (EQH16_00165) | - | 28168..28464 (+) | 297 | WP_050090589.1 | hypothetical protein | - |
| EQH16_RS00165 (EQH16_00170) | - | 28457..29284 (+) | 828 | WP_001289767.1 | phage replisome organizer N-terminal domain-containing protein | - |
| EQH16_RS00170 | - | 29272..29430 (+) | 159 | WP_000511764.1 | hypothetical protein | - |
| EQH16_RS00175 (EQH16_00175) | - | 29424..30194 (+) | 771 | WP_000228216.1 | ATP-binding protein | - |
| EQH16_RS00180 (EQH16_00180) | - | 30209..30403 (+) | 195 | WP_000470343.1 | hypothetical protein | - |
| EQH16_RS00185 (EQH16_00185) | - | 30403..30621 (+) | 219 | WP_050150962.1 | hypothetical protein | - |
| EQH16_RS00190 (EQH16_00190) | - | 30621..30926 (+) | 306 | WP_050096705.1 | hypothetical protein | - |
| EQH16_RS00195 (EQH16_00195) | - | 31003..31101 (+) | 99 | Protein_33 | single-stranded DNA-binding protein | - |
| EQH16_RS00200 (EQH16_00200) | - | 31115..31282 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| EQH16_RS00205 (EQH16_00205) | - | 31269..31478 (+) | 210 | WP_050096706.1 | hypothetical protein | - |
| EQH16_RS00210 (EQH16_00210) | - | 31453..31767 (+) | 315 | WP_050254373.1 | hypothetical protein | - |
| EQH16_RS00215 (EQH16_00215) | - | 31769..32278 (+) | 510 | WP_061751220.1 | DUF1642 domain-containing protein | - |
| EQH16_RS00220 (EQH16_00220) | - | 32275..32562 (+) | 288 | WP_088783325.1 | hypothetical protein | - |
| EQH16_RS00225 (EQH16_00225) | - | 32562..32750 (+) | 189 | WP_001277861.1 | hypothetical protein | - |
| EQH16_RS00230 (EQH16_00230) | - | 32747..33085 (+) | 339 | WP_061751218.1 | hypothetical protein | - |
| EQH16_RS00235 (EQH16_00235) | - | 33087..33347 (+) | 261 | WP_001252173.1 | DUF1372 family protein | - |
| EQH16_RS00240 (EQH16_00240) | - | 33347..33805 (+) | 459 | WP_000340952.1 | hypothetical protein | - |
| EQH16_RS00250 (EQH16_00250) | - | 33917..34267 (+) | 351 | WP_000600987.1 | YopX family protein | - |
| EQH16_RS00255 (EQH16_00255) | - | 34285..34686 (+) | 402 | WP_000736388.1 | transcriptional activator | - |
| EQH16_RS00260 (EQH16_00260) | - | 34877..35419 (+) | 543 | WP_000397549.1 | site-specific integrase | - |
| EQH16_RS00265 (EQH16_00265) | - | 35584..35775 (+) | 192 | WP_000238198.1 | hypothetical protein | - |
| EQH16_RS00270 (EQH16_00270) | - | 35895..36215 (+) | 321 | WP_000282422.1 | HNH endonuclease | - |
| EQH16_RS00275 (EQH16_00275) | - | 36352..36744 (+) | 393 | WP_001118282.1 | P27 family phage terminase small subunit | - |
| EQH16_RS00280 (EQH16_00280) | - | 36737..38467 (+) | 1731 | WP_000527303.1 | terminase large subunit | - |
| EQH16_RS00285 (EQH16_00285) | - | 38475..38693 (+) | 219 | WP_001002923.1 | hypothetical protein | - |
| EQH16_RS00290 (EQH16_00290) | - | 38711..39913 (+) | 1203 | WP_000510807.1 | phage portal protein | - |
| EQH16_RS00295 (EQH16_00295) | - | 39897..40472 (+) | 576 | WP_001172113.1 | HK97 family phage prohead protease | - |
| EQH16_RS00300 (EQH16_00300) | - | 40469..41641 (+) | 1173 | WP_001037661.1 | phage major capsid protein | - |
| EQH16_RS00305 (EQH16_00305) | - | 41653..41943 (+) | 291 | WP_000120767.1 | hypothetical protein | - |
| EQH16_RS00310 (EQH16_00310) | - | 41946..42227 (+) | 282 | WP_000371962.1 | phage head-tail connector protein | - |
| EQH16_RS00315 (EQH16_00315) | - | 42214..42513 (+) | 300 | WP_238090275.1 | phage head closure protein | - |
| EQH16_RS00320 (EQH16_00320) | - | 42510..42857 (+) | 348 | WP_000063886.1 | HK97 gp10 family phage protein | - |
| EQH16_RS00325 (EQH16_00325) | - | 42854..43177 (+) | 324 | WP_000777003.1 | hypothetical protein | - |
| EQH16_RS00330 (EQH16_00330) | - | 43189..43767 (+) | 579 | WP_000191278.1 | major tail protein | - |
| EQH16_RS00335 (EQH16_00335) | - | 43779..44198 (+) | 420 | WP_061644443.1 | hypothetical protein | - |
| EQH16_RS00340 (EQH16_00340) | - | 44476..47562 (+) | 3087 | WP_238090276.1 | phage tail tape measure protein | - |
| EQH16_RS00345 (EQH16_00345) | - | 47559..48281 (+) | 723 | WP_000589853.1 | hypothetical protein | - |
| EQH16_RS00350 (EQH16_00350) | - | 48282..56336 (+) | 8055 | WP_238090277.1 | phage tail spike protein | - |
| EQH16_RS11160 (EQH16_00355) | - | 56333..56449 (+) | 117 | WP_001063633.1 | hypothetical protein | - |
| EQH16_RS00355 (EQH16_00360) | - | 56430..56633 (+) | 204 | WP_001091118.1 | hypothetical protein | - |
| EQH16_RS00360 (EQH16_00365) | - | 56636..56986 (+) | 351 | WP_000852248.1 | hypothetical protein | - |
| EQH16_RS00365 (EQH16_00370) | - | 56996..57412 (+) | 417 | WP_001165341.1 | phage holin family protein | - |
| EQH16_RS00370 (EQH16_00375) | - | 57416..57748 (+) | 333 | WP_001186228.1 | phage holin | - |
| EQH16_RS00375 (EQH16_00380) | - | 57752..58708 (+) | 957 | WP_050197950.1 | N-acetylmuramoyl-L-alanine amidase | - |
| EQH16_RS00380 (EQH16_00385) | - | 58846..59025 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| EQH16_RS00385 | - | 59167..59316 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| EQH16_RS00390 (EQH16_00390) | tadA | 59598..60065 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| EQH16_RS00400 (EQH16_00400) | - | 60252..60695 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| EQH16_RS00405 (EQH16_00405) | - | 60697..61212 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| EQH16_RS00410 (EQH16_00410) | radA | 61226..62587 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| EQH16_RS00415 (EQH16_00415) | - | 62660..63157 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| EQH16_RS00420 (EQH16_00420) | - | 63182..63965 (+) | 784 | Protein_77 | PrsW family glutamic-type intramembrane protease | - |
| EQH16_RS00425 (EQH16_00425) | - | 64110..65078 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| EQH16_RS00430 (EQH16_00430) | - | 65212..65493 (-) | 282 | Protein_79 | ISL3 family transposase | - |
| EQH16_RS00435 | - | 65620..66527 (-) | 908 | Protein_80 | Rpn family recombination-promoting nuclease/putative transposase | - |
| EQH16_RS00440 (EQH16_00450) | polA | 66783..69416 (+) | 2634 | WP_001854987.1 | DNA polymerase I | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9667.10 Da Isoelectric Point: 6.4701
>NTDB_id=338591 EQH16_RS00110 WP_000939544.1 21539..21775(+) (comW) [Streptococcus pneumoniae strain TVO_1901921]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=338591 EQH16_RS00110 WP_000939544.1 21539..21775(+) (comW) [Streptococcus pneumoniae strain TVO_1901921]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
78.205 |
100 |
0.782 |
| comW | Streptococcus mitis NCTC 12261 |
77.922 |
98.718 |
0.769 |