Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | EQH19_RS10685 | Genome accession | NZ_CP035261 |
| Coordinates | 2083389..2083514 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain TVO_1901924 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| IS/Tn | 2081143..2082489 | 2083389..2083514 | flank | 900 |
Gene organization within MGE regions
Location: 2081143..2083514
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH19_RS10675 (EQH19_11265) | - | 2081143..2082489 (+) | 1347 | WP_001808790.1 | IS1380-like element ISSpn5 family transposase | - |
| EQH19_RS10680 (EQH19_11270) | comD | 2082682..2083368 (-) | 687 | Protein_2082 | competence system sensor histidine kinase ComD | - |
| EQH19_RS10685 (EQH19_11275) | comC/comC1 | 2083389..2083514 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=338429 EQH19_RS10685 WP_000799689.1 2083389..2083514(-) (comC/comC1) [Streptococcus pneumoniae strain TVO_1901924]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=338429 EQH19_RS10685 WP_000799689.1 2083389..2083514(-) (comC/comC1) [Streptococcus pneumoniae strain TVO_1901924]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |