Detailed information
Overview
| Name | comGD/cglD | Type | Machinery gene |
| Locus tag | EQH24_RS10210 | Genome accession | NZ_CP035256 |
| Coordinates | 1967498..1967902 (-) | Length | 134 a.a. |
| NCBI ID | WP_000588023.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1901930 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1968652..2019658 | 1967498..1967902 | flank | 750 |
Gene organization within MGE regions
Location: 1967498..2019658
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH24_RS10210 (EQH24_10735) | comGD/cglD | 1967498..1967902 (-) | 405 | WP_000588023.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| EQH24_RS10215 (EQH24_10740) | comGC/cglC | 1967895..1968161 (-) | 267 | WP_050129046.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EQH24_RS10220 (EQH24_10745) | - | 1968163..1968420 (-) | 258 | WP_238101663.1 | hypothetical protein | - |
| EQH24_RS10225 (EQH24_10750) | - | 1968652..1969608 (-) | 957 | WP_000350480.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| EQH24_RS10230 (EQH24_10755) | - | 1969612..1969944 (-) | 333 | WP_001186219.1 | phage holin | - |
| EQH24_RS10235 (EQH24_10760) | - | 1969948..1970247 (-) | 300 | WP_001811580.1 | hypothetical protein | - |
| EQH24_RS10240 (EQH24_10765) | - | 1970256..1970606 (-) | 351 | WP_000852245.1 | hypothetical protein | - |
| EQH24_RS10245 (EQH24_10770) | - | 1970609..1970812 (-) | 204 | WP_001091123.1 | hypothetical protein | - |
| EQH24_RS10250 (EQH24_10775) | - | 1970793..1970909 (-) | 117 | WP_001063632.1 | hypothetical protein | - |
| EQH24_RS11915 | - | 1970906..1977322 (-) | 6417 | WP_409202213.1 | tail fiber domain-containing protein | - |
| EQH24_RS11920 | - | 1978268..1981630 (-) | 3363 | Protein_2027 | peptidase S74 | - |
| EQH24_RS10260 (EQH24_10785) | - | 1981635..1981985 (-) | 351 | WP_000068031.1 | DUF6711 family protein | - |
| EQH24_RS10265 (EQH24_10790) | - | 1981994..1985668 (-) | 3675 | WP_238101665.1 | hypothetical protein | - |
| EQH24_RS10270 (EQH24_10795) | - | 1985655..1986005 (-) | 351 | WP_000478007.1 | hypothetical protein | - |
| EQH24_RS10275 (EQH24_10800) | - | 1986044..1986424 (-) | 381 | WP_001185629.1 | DUF6096 family protein | - |
| EQH24_RS10280 (EQH24_10805) | - | 1986429..1986842 (-) | 414 | WP_000880676.1 | phage tail tube protein | - |
| EQH24_RS10285 (EQH24_10810) | - | 1986845..1987213 (-) | 369 | WP_000608232.1 | hypothetical protein | - |
| EQH24_RS10290 (EQH24_10815) | - | 1987210..1987725 (-) | 516 | WP_000015941.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EQH24_RS10295 (EQH24_10820) | - | 1987700..1988038 (-) | 339 | WP_000478945.1 | hypothetical protein | - |
| EQH24_RS10300 (EQH24_10825) | - | 1988019..1988330 (-) | 312 | WP_000021222.1 | phage head-tail connector protein | - |
| EQH24_RS10305 (EQH24_10830) | - | 1988332..1988520 (-) | 189 | WP_000669349.1 | hypothetical protein | - |
| EQH24_RS10310 (EQH24_10835) | - | 1988510..1988692 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| EQH24_RS10315 (EQH24_10840) | - | 1988704..1989549 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| EQH24_RS10320 (EQH24_10845) | - | 1989556..1990140 (-) | 585 | WP_001288024.1 | DUF4355 domain-containing protein | - |
| EQH24_RS10325 (EQH24_10850) | - | 1990310..1990522 (-) | 213 | WP_000393349.1 | crAss001_48 related protein | - |
| EQH24_RS10330 | - | 1990667..1990840 (-) | 174 | WP_000379086.1 | hypothetical protein | - |
| EQH24_RS10335 (EQH24_10855) | - | 1990991..1992541 (-) | 1551 | WP_179208665.1 | minor capsid protein | - |
| EQH24_RS10340 (EQH24_10860) | - | 1992450..1993919 (-) | 1470 | WP_238101666.1 | phage portal protein | - |
| EQH24_RS10345 (EQH24_10865) | - | 1993931..1995229 (-) | 1299 | WP_000084429.1 | PBSX family phage terminase large subunit | - |
| EQH24_RS10350 (EQH24_10870) | - | 1995207..1995647 (-) | 441 | WP_014931818.1 | terminase small subunit | - |
| EQH24_RS10360 (EQH24_10875) | - | 1996121..1996543 (-) | 423 | WP_001030244.1 | DUF1492 domain-containing protein | - |
| EQH24_RS10365 (EQH24_10880) | - | 1996613..1996984 (-) | 372 | WP_001247151.1 | hypothetical protein | - |
| EQH24_RS10370 (EQH24_10885) | - | 1996981..1997418 (-) | 438 | WP_000612395.1 | YopX family protein | - |
| EQH24_RS10375 (EQH24_10890) | - | 1997437..1997886 (-) | 450 | WP_001132423.1 | hypothetical protein | - |
| EQH24_RS10380 (EQH24_10895) | - | 1997889..1998821 (-) | 933 | WP_228114830.1 | DUF1642 domain-containing protein | - |
| EQH24_RS10385 (EQH24_10900) | - | 1998823..1999140 (-) | 318 | WP_179132006.1 | hypothetical protein | - |
| EQH24_RS10390 (EQH24_10905) | - | 1999165..1999347 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| EQH24_RS10395 (EQH24_10910) | - | 1999363..1999794 (-) | 432 | WP_000779141.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EQH24_RS10400 (EQH24_10915) | - | 1999791..2000120 (-) | 330 | WP_001864270.1 | hypothetical protein | - |
| EQH24_RS10405 (EQH24_10920) | - | 2000134..2000343 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| EQH24_RS10410 (EQH24_10925) | - | 2000309..2000815 (-) | 507 | WP_000034831.1 | class I SAM-dependent methyltransferase | - |
| EQH24_RS10415 (EQH24_10930) | ssbA | 2000825..2001241 (-) | 417 | WP_000609562.1 | single-stranded DNA-binding protein | Machinery gene |
| EQH24_RS10420 (EQH24_10935) | - | 2001336..2001671 (-) | 336 | WP_000598345.1 | sporulation protein Cse60 | - |
| EQH24_RS10425 (EQH24_10940) | - | 2001664..2001987 (-) | 324 | WP_001828022.1 | hypothetical protein | - |
| EQH24_RS10430 (EQH24_10945) | - | 2002155..2003195 (-) | 1041 | WP_001157037.1 | DUF1351 domain-containing protein | - |
| EQH24_RS10435 (EQH24_10950) | bet | 2003205..2003957 (-) | 753 | WP_050208850.1 | phage recombination protein Bet | - |
| EQH24_RS10440 (EQH24_10955) | - | 2003975..2004160 (-) | 186 | WP_000746960.1 | hypothetical protein | - |
| EQH24_RS10445 (EQH24_10960) | - | 2004464..2004718 (-) | 255 | WP_050250076.1 | hypothetical protein | - |
| EQH24_RS10450 (EQH24_10965) | - | 2004711..2004914 (-) | 204 | WP_050250075.1 | hypothetical protein | - |
| EQH24_RS10455 | - | 2004914..2005075 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| EQH24_RS10460 | - | 2005140..2005283 (-) | 144 | WP_000389589.1 | hypothetical protein | - |
| EQH24_RS10465 (EQH24_10970) | - | 2005402..2005593 (+) | 192 | WP_000834563.1 | hypothetical protein | - |
| EQH24_RS10470 (EQH24_10980) | - | 2005868..2006194 (-) | 327 | WP_050250036.1 | replication protein | - |
| EQH24_RS10475 (EQH24_10985) | - | 2006358..2006546 (-) | 189 | WP_001161207.1 | helix-turn-helix transcriptional regulator | - |
| EQH24_RS10480 (EQH24_10990) | - | 2006620..2006826 (+) | 207 | WP_000129515.1 | hypothetical protein | - |
| EQH24_RS10485 | - | 2007051..2007221 (-) | 171 | WP_000660186.1 | hypothetical protein | - |
| EQH24_RS10490 (EQH24_11000) | - | 2007420..2008109 (+) | 690 | WP_000577515.1 | DUF4145 domain-containing protein | - |
| EQH24_RS10495 (EQH24_11005) | - | 2008269..2008544 (-) | 276 | WP_001094375.1 | hypothetical protein | - |
| EQH24_RS10500 (EQH24_11010) | - | 2008699..2009487 (+) | 789 | WP_050116194.1 | S24 family peptidase | - |
| EQH24_RS10505 (EQH24_11015) | - | 2009489..2009689 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| EQH24_RS10510 (EQH24_11020) | - | 2009871..2011316 (+) | 1446 | WP_061385035.1 | recombinase family protein | - |
| EQH24_RS10520 (EQH24_11030) | comGB/cglB | 2011398..2012414 (-) | 1017 | WP_073177425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| EQH24_RS10525 (EQH24_11035) | comGA/cglA/cilD | 2012362..2013303 (-) | 942 | WP_000249559.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| EQH24_RS10530 (EQH24_11040) | - | 2013379..2013744 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| EQH24_RS10535 (EQH24_11045) | - | 2014012..2015267 (+) | 1256 | WP_408604980.1 | ISL3 family transposase | - |
| EQH24_RS10540 (EQH24_11050) | - | 2015316..2016374 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| EQH24_RS10545 (EQH24_11055) | nagA | 2016537..2017688 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| EQH24_RS10550 (EQH24_11060) | - | 2017841..2019658 (-) | 1818 | WP_001220838.1 | acyltransferase family protein | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 14638.82 Da Isoelectric Point: 10.2164
>NTDB_id=338027 EQH24_RS10210 WP_000588023.1 1967498..1967902(-) (comGD/cglD) [Streptococcus pneumoniae strain TVO_1901930]
MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTLSNGSQKLTV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTLSNGSQKLTV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
Nucleotide
Download Length: 405 bp
>NTDB_id=338027 EQH24_RS10210 WP_000588023.1 1967498..1967902(-) (comGD/cglD) [Streptococcus pneumoniae strain TVO_1901930]
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCGGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGCTTAGCAATGGCAGTCAAAAGTTGACAGTT
CCTAAAGGAATTCAGGCACCATCAGGCCAAAGTATTACATTTGACCGAGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCGGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGCTTAGCAATGGCAGTCAAAAGTTGACAGTT
CCTAAAGGAATTCAGGCACCATCAGGCCAAAGTATTACATTTGACCGAGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
98.507 |
100 |
0.985 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus pneumoniae D39 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus pneumoniae R6 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus mitis SK321 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
97.744 |
99.254 |
0.97 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
58.268 |
94.776 |
0.552 |
| comYD | Streptococcus mutans UA140 |
49.219 |
95.522 |
0.47 |
| comYD | Streptococcus mutans UA159 |
49.219 |
95.522 |
0.47 |