Detailed information NTG0337409

Bioinformatically predicted

Overview

• Name: comA/nlmT
• Type: Regulator
• Locus tag: EQH35_RS10705
• Genome accession: NZ_CP035245
• Coordinates: 493727..494167 (-)
• Length: 146 a.a.
• NCBI ID: WP_001808911.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain TVO_1901943
• Function: transport of ComC (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	485868..495414	493727..494167	within	0

Gene organization within MGE regions

Location: 485868..495414

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EQH35_RS02555 (EQH35_02680)	-	485868..486155 (-)	288	WP_000777760.1	hypothetical protein	-
EQH35_RS02560 (EQH35_02685)	-	486165..486575 (-)	411	WP_001278301.1	HIT family protein	-
EQH35_RS02565 (EQH35_02690)	pptA	486643..487374 (+)	732	WP_000889923.1	ABC transporter ATP-binding protein	Regulator
EQH35_RS02570 (EQH35_02695)	-	487371..488420 (+)	1050	WP_000653752.1	ABC transporter permease	-
EQH35_RS02575 (EQH35_02700)	-	488588..488917 (-)	330	WP_000132570.1	hypothetical protein	-
EQH35_RS02580 (EQH35_02705)	-	489195..489533 (+)	339	WP_000682119.1	LytTR family DNA-binding domain-containing protein	-
EQH35_RS02585 (EQH35_02710)	comE/blpR	489538..490275 (+)	738	WP_001219127.1	response regulator transcription factor	Regulator
EQH35_RS02590 (EQH35_02715)	-	490289..491629 (+)	1341	WP_001017622.1	sensor histidine kinase	-
EQH35_RS02595 (EQH35_02720)	blpC	491671..491826 (-)	156	WP_000358813.1	quorum-sensing system pheromone BlpC	-
EQH35_RS02600 (EQH35_02725)	-	491883..493244 (-)	1362	WP_001069092.1	bacteriocin secretion accessory protein	-
EQH35_RS10700	comA/nlmT	493255..493743 (-)	489	WP_307774349.1	ATP-binding cassette domain-containing protein	Regulator
EQH35_RS10705	comA/nlmT	493727..494167 (-)	441	WP_001808911.1	ATP-binding cassette domain-containing protein	Regulator
EQH35_RS10710	comA/nlmT	494157..494882 (-)	726	WP_167750760.1	ABC transporter transmembrane domain-containing protein	Regulator
EQH35_RS10715 (EQH35_02735)	comA/nlmT	494827..495414 (-)	588	WP_000205166.1	cysteine peptidase family C39 domain-containing protein	Regulator

Sequence

Protein

• Length: 146 a.a.
• Molecular weight: 16438.75 Da
• Isoelectric Point: 6.8794

>NTDB_id=337409 EQH35_RS10705 WP_001808911.1 493727..494167(-) (comA/nlmT) [Streptococcus pneumoniae strain TVO_1901943]
MSSKISIGQLITFNTLLSYFTTPMENIINLQTKLQSAKVANNRLNEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYG
FGRDTLTDINLTIKQGDKVSLVGVSGSGKTTLAKMIVNFFEPYKGHISINHQDIKNIDKKSLAPSY

Nucleotide

• Length: 441 bp

>NTDB_id=337409 EQH35_RS10705 WP_001808911.1 493727..494167(-) (comA/nlmT) [Streptococcus pneumoniae strain TVO_1901943]
ATGTCGAGTAAAATTTCTATCGGTCAGCTGATTACCTTTAACACACTTCTTTCTTACTTTACAACTCCTATGGAAAATAT
TATCAACCTCCAAACCAAACTCCAATCTGCGAAGGTCGCTAATAACCGTTTGAACGAAGTCTATCTAGTCGAATCTGAAT
TTCAAGTTCAAGAAAACCCTGTTCATTCACATTTTTTGATGGGCGATATTGAATTTGATGACCTTTCTTATAAGTATGGT
TTTGGACGAGATACCTTAACAGATATTAATCTCACGATTAAACAAGGAGATAAGGTTAGCCTAGTTGGAGTTAGTGGTTC
TGGTAAAACAACTTTAGCCAAAATGATTGTCAATTTCTTTGAACCCTACAAAGGGCATATTTCCATCAATCATCAGGATA
TTAAAAACATTGATAAAAAAAGTCTTGCGCCGTCATATTAA

Domains

Predicted by InterproScan.

• ABC transporter (ABC_tran) (86-142)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comA/nlmT	Streptococcus mutans UA159	71.127	97.26	0.692
comA	Streptococcus mitis NCTC 12261	63.38	97.26	0.616
comA	Streptococcus pneumoniae TIGR4	61.972	97.26	0.603
comA	Streptococcus pneumoniae Rx1	61.972	97.26	0.603
comA	Streptococcus pneumoniae D39	61.972	97.26	0.603
comA	Streptococcus pneumoniae R6	61.972	97.26	0.603
comA	Streptococcus mitis SK321	61.972	97.26	0.603
comA	Streptococcus gordonii str. Challis substr. CH1	59.028	98.63	0.582