Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | EQH37_RS10780 | Genome accession | NZ_CP035243 |
| Coordinates | 2137932..2138057 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain TVO_1901946 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2132932..2143057
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH37_RS10750 | - | 2133271..2134873 (-) | 1603 | Protein_2108 | YhgE/Pip family protein | - |
| EQH37_RS10755 (EQH37_11370) | - | 2135052..2135594 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| EQH37_RS10770 (EQH37_11385) | comE | 2135837..2136589 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| EQH37_RS10775 (EQH37_11390) | comD/comD2 | 2136586..2137911 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| EQH37_RS10780 (EQH37_11395) | comC/comC2 | 2137932..2138057 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| EQH37_RS10790 (EQH37_11405) | rlmH | 2138339..2138818 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| EQH37_RS10795 (EQH37_11410) | htrA | 2139001..2140182 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| EQH37_RS10800 (EQH37_11415) | spo0J | 2140240..2140998 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=337254 EQH37_RS10780 WP_000799686.1 2137932..2138057(-) (comC/comC2) [Streptococcus pneumoniae strain TVO_1901946]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=337254 EQH37_RS10780 WP_000799686.1 2137932..2138057(-) (comC/comC2) [Streptococcus pneumoniae strain TVO_1901946]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |