Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | EQH41_RS10825 | Genome accession | NZ_CP035239 |
| Coordinates | 2150562..2150687 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain TVO_TIGR4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2145562..2155687
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH41_RS10795 | - | 2145901..2147503 (-) | 1603 | Protein_2122 | YhgE/Pip family protein | - |
| EQH41_RS10800 (EQH41_11495) | - | 2147682..2148224 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| EQH41_RS10815 (EQH41_11510) | comE | 2148467..2149219 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| EQH41_RS10820 (EQH41_11515) | comD/comD2 | 2149216..2150541 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| EQH41_RS10825 (EQH41_11520) | comC/comC2 | 2150562..2150687 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| EQH41_RS10835 (EQH41_11530) | rlmH | 2150969..2151448 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| EQH41_RS10840 (EQH41_11535) | htrA | 2151631..2152812 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| EQH41_RS10845 (EQH41_11540) | spo0J | 2152870..2153628 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=337019 EQH41_RS10825 WP_000799686.1 2150562..2150687(-) (comC/comC2) [Streptococcus pneumoniae strain TVO_TIGR4]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=337019 EQH41_RS10825 WP_000799686.1 2150562..2150687(-) (comC/comC2) [Streptococcus pneumoniae strain TVO_TIGR4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |