Detailed information
Overview
| Name | comC | Type | Regulator |
| Locus tag | EQH44_RS10630 | Genome accession | NZ_CP035236 |
| Coordinates | 2100293..2100424 (-) | Length | 43 a.a. |
| NCBI ID | WP_061649796.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain TVO_1902282 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2095293..2105424
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQH44_RS10600 (EQH44_11200) | - | 2095646..2096188 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| EQH44_RS10615 (EQH44_11215) | - | 2096549..2097946 (+) | 1398 | WP_001812112.1 | ISNCY-like element IS1202 family transposase | - |
| EQH44_RS10770 | - | 2098019..2098144 (+) | 126 | WP_001258159.1 | hypothetical protein | - |
| EQH44_RS10620 (EQH44_11220) | comE | 2098206..2098958 (-) | 753 | WP_000866075.1 | competence system response regulator transcription factor ComE | Regulator |
| EQH44_RS10625 (EQH44_11225) | comD/comD1 | 2098955..2100280 (-) | 1326 | WP_025169508.1 | competence system sensor histidine kinase ComD | Regulator |
| EQH44_RS10630 (EQH44_11230) | comC | 2100293..2100424 (-) | 132 | WP_061649796.1 | competence-stimulating peptide ComC | Regulator |
| EQH44_RS10640 (EQH44_11240) | rlmH | 2100706..2101185 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| EQH44_RS10645 (EQH44_11245) | htrA | 2101368..2102549 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| EQH44_RS10650 (EQH44_11250) | spo0J | 2102607..2103365 (+) | 759 | WP_000410381.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 43 a.a. Molecular weight: 5299.18 Da Isoelectric Point: 11.0565
>NTDB_id=336789 EQH44_RS10630 WP_061649796.1 2100293..2100424(-) (comC) [Streptococcus pneumoniae strain TVO_1902282]
MKNTVKLEQFVALKEKDLQNIQGGEMRKMNEKSFNFFNFFRRR
MKNTVKLEQFVALKEKDLQNIQGGEMRKMNEKSFNFFNFFRRR
Nucleotide
Download Length: 132 bp
>NTDB_id=336789 EQH44_RS10630 WP_061649796.1 2100293..2100424(-) (comC) [Streptococcus pneumoniae strain TVO_1902282]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATGAG
GAAAATGAATGAAAAGTCCTTTAATTTCTTTAATTTCTTTAGAAGAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTGCAAAATATTCAAGGTGGGGAGATGAG
GAAAATGAATGAAAAGTCCTTTAATTTCTTTAATTTCTTTAGAAGAAGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
67.442 |
100 |
0.674 |
| comC/comC2 | Streptococcus pneumoniae A66 |
92.593 |
62.791 |
0.581 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae R6 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae G54 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae D39 |
92.593 |
62.791 |
0.581 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
92.593 |
62.791 |
0.581 |
| comC | Streptococcus mitis SK321 |
92.593 |
62.791 |
0.581 |