Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   EQI48_RS12530 Genome accession   NZ_CP035164
Coordinates   2423592..2423966 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM104005     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2418592..2428966
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI48_RS12490 (EQI48_12490) yqhG 2418923..2419717 (+) 795 WP_015714249.1 YqhG family protein -
  EQI48_RS12495 (EQI48_12495) sinI 2419900..2420073 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI48_RS12500 (EQI48_12500) sinR 2420107..2420442 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI48_RS12505 (EQI48_12505) tasA 2420535..2421320 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQI48_RS12510 (EQI48_12510) sipW 2421384..2421956 (-) 573 WP_072692741.1 signal peptidase I SipW -
  EQI48_RS12515 (EQI48_12515) tapA 2421940..2422701 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  EQI48_RS12520 (EQI48_12520) yqzG 2422973..2423299 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI48_RS12525 (EQI48_12525) spoIITA 2423341..2423520 (-) 180 WP_029726723.1 YqzE family protein -
  EQI48_RS12530 (EQI48_12530) comGG 2423592..2423966 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  EQI48_RS12535 (EQI48_12535) comGF 2423967..2424350 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  EQI48_RS12540 (EQI48_12540) comGE 2424376..2424723 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  EQI48_RS12545 (EQI48_12545) comGD 2424707..2425138 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  EQI48_RS12550 (EQI48_12550) comGC 2425128..2425424 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  EQI48_RS12555 (EQI48_12555) comGB 2425438..2426475 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  EQI48_RS12560 (EQI48_12560) comGA 2426462..2427532 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  EQI48_RS12565 (EQI48_12565) - 2427745..2427942 (-) 198 WP_029726717.1 hypothetical protein -
  EQI48_RS12570 (EQI48_12570) corA 2427944..2428897 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=335199 EQI48_RS12530 WP_029726722.1 2423592..2423966(-) (comGG) [Bacillus subtilis strain SRCM104005]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=335199 EQI48_RS12530 WP_029726722.1 2423592..2423966(-) (comGG) [Bacillus subtilis strain SRCM104005]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment