Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   EQI48_RS12495 Genome accession   NZ_CP035164
Coordinates   2419900..2420073 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM104005     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2414900..2425073
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EQI48_RS12480 (EQI48_12480) gcvT 2415700..2416788 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  EQI48_RS12485 (EQI48_12485) hepAA 2417229..2418902 (+) 1674 WP_029726726.1 SNF2-related protein -
  EQI48_RS12490 (EQI48_12490) yqhG 2418923..2419717 (+) 795 WP_015714249.1 YqhG family protein -
  EQI48_RS12495 (EQI48_12495) sinI 2419900..2420073 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  EQI48_RS12500 (EQI48_12500) sinR 2420107..2420442 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  EQI48_RS12505 (EQI48_12505) tasA 2420535..2421320 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  EQI48_RS12510 (EQI48_12510) sipW 2421384..2421956 (-) 573 WP_072692741.1 signal peptidase I SipW -
  EQI48_RS12515 (EQI48_12515) tapA 2421940..2422701 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  EQI48_RS12520 (EQI48_12520) yqzG 2422973..2423299 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  EQI48_RS12525 (EQI48_12525) spoIITA 2423341..2423520 (-) 180 WP_029726723.1 YqzE family protein -
  EQI48_RS12530 (EQI48_12530) comGG 2423592..2423966 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  EQI48_RS12535 (EQI48_12535) comGF 2423967..2424350 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  EQI48_RS12540 (EQI48_12540) comGE 2424376..2424723 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=335197 EQI48_RS12495 WP_003230187.1 2419900..2420073(+) (sinI) [Bacillus subtilis strain SRCM104005]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=335197 EQI48_RS12495 WP_003230187.1 2419900..2420073(+) (sinI) [Bacillus subtilis strain SRCM104005]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment