Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | SPJ_RS00135 | Genome accession | NC_012466 |
| Coordinates | 22366..22602 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939544.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae JJA | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12371..44471 | 22366..22602 | within | 0 |
| IScluster/Tn | 20422..22049 | 22366..22602 | flank | 317 |
Gene organization within MGE regions
Location: 12371..44471
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPJ_RS00065 (SPJ_0013) | ftsH | 12371..14329 (+) | 1959 | WP_000744545.1 | ATP-dependent zinc metalloprotease FtsH | - |
| SPJ_RS00070 (SPJ_0014) | comX/comX2 | 14451..14930 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| SPJ_RS11325 | - | 20422..21268 (+) | 847 | Protein_14 | IS630 family transposase | - |
| SPJ_RS11330 | - | 21303..22100 (-) | 798 | Protein_15 | transposase | - |
| SPJ_RS00135 (SPJ_0027) | comW | 22366..22602 (+) | 237 | WP_000939544.1 | sigma(X)-activator ComW | Regulator |
| SPJ_RS00140 (SPJ_0028) | - | 22833..24119 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| SPJ_RS00145 (SPJ_0029) | tadA | 24320..24787 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| SPJ_RS13150 (SPJ_0030) | - | 24996..25694 (-) | 699 | WP_001106362.1 | site-specific integrase | - |
| SPJ_RS13155 (SPJ_0031) | - | 25784..26131 (-) | 348 | WP_001839379.1 | hypothetical protein | - |
| SPJ_RS00160 (SPJ_0032) | - | 26192..27262 (-) | 1071 | WP_000401841.1 | type I restriction endonuclease | - |
| SPJ_RS00165 (SPJ_0033) | - | 27279..27659 (-) | 381 | WP_000170931.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPJ_RS00170 (SPJ_0034) | - | 27672..27935 (-) | 264 | WP_000285962.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| SPJ_RS00175 (SPJ_0035) | - | 27935..28168 (-) | 234 | WP_000156419.1 | hypothetical protein | - |
| SPJ_RS00180 (SPJ_0036) | - | 28168..28536 (-) | 369 | WP_000464160.1 | helix-turn-helix transcriptional regulator | - |
| SPJ_RS00185 (SPJ_0038) | - | 29108..29299 (+) | 192 | WP_001112859.1 | DNA-binding protein | - |
| SPJ_RS00190 (SPJ_0039) | - | 29322..29525 (+) | 204 | WP_001247549.1 | hypothetical protein | - |
| SPJ_RS11340 (SPJ_0040) | - | 29680..29847 (-) | 168 | WP_000024181.1 | YjzC family protein | - |
| SPJ_RS00195 (SPJ_0042) | - | 29867..30232 (+) | 366 | Protein_29 | autolysin | - |
| SPJ_RS00200 (SPJ_0043) | - | 30452..30631 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| SPJ_RS12935 | - | 30773..30922 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| SPJ_RS00205 (SPJ_0045) | - | 31227..31670 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| SPJ_RS00210 (SPJ_0046) | - | 31672..32187 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| SPJ_RS00215 (SPJ_0047) | radA | 32201..33562 (+) | 1362 | WP_075213698.1 | DNA repair protein RadA | Machinery gene |
| SPJ_RS00220 (SPJ_0048) | - | 33635..34132 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| SPJ_RS00225 (SPJ_0049) | - | 34157..34940 (+) | 784 | Protein_36 | PrsW family glutamic-type intramembrane protease | - |
| SPJ_RS00235 (SPJ_0051) | - | 35085..36053 (+) | 969 | WP_000010157.1 | ribose-phosphate diphosphokinase | - |
| SPJ_RS11345 (SPJ_0052) | - | 36187..36468 (-) | 282 | Protein_38 | ISL3 family transposase | - |
| SPJ_RS13130 | - | 36595..37502 (-) | 908 | Protein_39 | Rpn family recombination-promoting nuclease/putative transposase | - |
| SPJ_RS00255 (SPJ_0056) | polA | 37758..40391 (+) | 2634 | WP_000358437.1 | DNA polymerase I | - |
| SPJ_RS00260 (SPJ_0057) | - | 40476..40913 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| SPJ_RS00265 (SPJ_0058) | - | 41376..42386 (-) | 1011 | WP_000009143.1 | YeiH family protein | - |
| SPJ_RS00270 (SPJ_0059) | - | 42535..43704 (+) | 1170 | WP_000366378.1 | pyridoxal phosphate-dependent aminotransferase | - |
| SPJ_RS00275 (SPJ_0060) | recO | 43701..44471 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9667.10 Da Isoelectric Point: 6.4701
>NTDB_id=33126 SPJ_RS00135 WP_000939544.1 22366..22602(+) (comW) [Streptococcus pneumoniae JJA]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCHRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=33126 SPJ_RS00135 WP_000939544.1 22366..22602(+) (comW) [Streptococcus pneumoniae JJA]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCATAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae D39 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae R6 |
97.436 |
100 |
0.974 |
| comW | Streptococcus pneumoniae TIGR4 |
97.436 |
100 |
0.974 |
| comW | Streptococcus mitis SK321 |
78.205 |
100 |
0.782 |
| comW | Streptococcus mitis NCTC 12261 |
77.922 |
98.718 |
0.769 |