Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D8X56_RS00285 Genome accession   NZ_CP034314
Coordinates   37650..37763 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain HP42K     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32650..42763
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D8X56_RS00260 (D8X56_00260) - 32703..34928 (+) 2226 WP_125301246.1 ATP-dependent Clp protease ATP-binding subunit -
  D8X56_RS00265 (D8X56_00265) panD 34918..35271 (+) 354 WP_000142250.1 aspartate 1-decarboxylase -
  D8X56_RS00270 (D8X56_00270) - 35274..35576 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  D8X56_RS00275 (D8X56_00275) - 35576..36571 (+) 996 WP_125303651.1 PDZ domain-containing protein -
  D8X56_RS00280 (D8X56_00280) comB6 36579..37634 (+) 1056 WP_125303649.1 P-type conjugative transfer protein TrbL Machinery gene
  D8X56_RS00285 (D8X56_00285) comB7 37650..37763 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  D8X56_RS00290 (D8X56_00290) comB8 37760..38503 (+) 744 WP_125301248.1 virB8 family protein Machinery gene
  D8X56_RS00295 (D8X56_00295) comB9 38503..39477 (+) 975 WP_125301250.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D8X56_RS00300 (D8X56_00300) comB10 39470..40606 (+) 1137 WP_125301252.1 DNA type IV secretion system protein ComB10 Machinery gene
  D8X56_RS00305 (D8X56_00305) - 40677..42089 (+) 1413 WP_125301254.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=330623 D8X56_RS00285 WP_001217873.1 37650..37763(+) (comB7) [Helicobacter pylori strain HP42K]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=330623 D8X56_RS00285 WP_001217873.1 37650..37763(+) (comB7) [Helicobacter pylori strain HP42K]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTATATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment