Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   D9779_RS13080 Genome accession   NZ_CP033052
Coordinates   2526424..2526852 (-) Length   142 a.a.
NCBI ID   WP_121642896.1    Uniprot ID   -
Organism   Bacillus vallismortis strain Bac111     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2521424..2531852
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9779_RS13030 sinI 2521624..2521797 (+) 174 WP_010328257.1 anti-repressor SinI Regulator
  D9779_RS13035 sinR 2521831..2522166 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9779_RS13040 tasA 2522251..2523036 (-) 786 WP_010328256.1 biofilm matrix protein TasA -
  D9779_RS13045 sipW 2523099..2523671 (-) 573 WP_082246288.1 signal peptidase I SipW -
  D9779_RS13050 tapA 2523655..2524419 (-) 765 WP_121642892.1 amyloid fiber anchoring/assembly protein TapA -
  D9779_RS13055 - 2524688..2525014 (+) 327 WP_026014435.1 YqzG/YhdC family protein -
  D9779_RS13060 - 2525058..2525237 (-) 180 WP_010328251.1 YqzE family protein -
  D9779_RS13065 comGG 2525309..2525683 (-) 375 WP_121642893.1 competence type IV pilus minor pilin ComGG Machinery gene
  D9779_RS13070 comGF 2525684..2526067 (-) 384 WP_121642894.1 competence type IV pilus minor pilin ComGF Machinery gene
  D9779_RS13075 comGE 2526093..2526440 (-) 348 WP_121642895.1 competence type IV pilus minor pilin ComGE Machinery gene
  D9779_RS13080 comGD 2526424..2526852 (-) 429 WP_121642896.1 competence type IV pilus minor pilin ComGD Machinery gene
  D9779_RS13085 comGC 2526842..2527138 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  D9779_RS13090 comGB 2527152..2528189 (-) 1038 WP_121642897.1 competence type IV pilus assembly protein ComGB Machinery gene
  D9779_RS13095 comGA 2528176..2529246 (-) 1071 WP_121642898.1 competence protein ComGA Machinery gene
  D9779_RS13105 - 2529458..2529868 (-) 411 WP_121642899.1 CBS domain-containing protein -
  D9779_RS13110 - 2529933..2530886 (-) 954 WP_010328242.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 15936.61 Da        Isoelectric Point: 10.0684

>NTDB_id=320868 D9779_RS13080 WP_121642896.1 2526424..2526852(-) (comGD) [Bacillus vallismortis strain Bac111]
MNIKLKEEGFTLLESLLVLSLASILLIAVFTALPPVYGNTAVRQAVWQLKSDILLAQQTAMSSHQRTKILFHRKEYQLVT
DAMVIERSYPTGLSIELLTLKDRLEFNEKGHPNTGGKLRVKGHAAYDITVYLGSGRVNVERK

Nucleotide


Download         Length: 429 bp        

>NTDB_id=320868 D9779_RS13080 WP_121642896.1 2526424..2526852(-) (comGD) [Bacillus vallismortis strain Bac111]
TTGAACATTAAATTAAAGGAGGAGGGATTTACTCTTTTAGAAAGTTTGCTTGTGTTAAGTCTCGCCTCTATCCTCTTAAT
TGCGGTGTTTACCGCACTTCCTCCTGTTTATGGGAATACAGCCGTTCGTCAGGCGGTATGGCAGCTGAAAAGTGATATTT
TGCTTGCGCAGCAGACTGCAATGTCCAGTCATCAAAGAACAAAAATTCTCTTTCACAGAAAAGAGTATCAGTTAGTCACG
GATGCAATGGTGATTGAAAGATCCTATCCGACAGGACTTTCTATAGAGCTGCTGACACTCAAAGACCGTTTGGAATTTAA
TGAGAAAGGGCATCCGAATACAGGCGGGAAATTACGCGTAAAAGGACATGCCGCTTATGACATCACAGTTTATTTAGGGA
GCGGAAGAGTTAATGTGGAGAGAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

83.217

100

0.838


Multiple sequence alignment