Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9779_RS13030 | Genome accession | NZ_CP033052 |
| Coordinates | 2521624..2521797 (+) | Length | 57 a.a. |
| NCBI ID | WP_010328257.1 | Uniprot ID | A0AAP3CME1 |
| Organism | Bacillus vallismortis strain Bac111 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2516624..2526797
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9779_RS13015 | gcvT | 2517422..2518510 (-) | 1089 | WP_121642890.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9779_RS13020 | - | 2518953..2520626 (+) | 1674 | WP_010328259.1 | DEAD/DEAH box helicase | - |
| D9779_RS13025 | - | 2520647..2521441 (+) | 795 | WP_121642891.1 | YqhG family protein | - |
| D9779_RS13030 | sinI | 2521624..2521797 (+) | 174 | WP_010328257.1 | anti-repressor SinI | Regulator |
| D9779_RS13035 | sinR | 2521831..2522166 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D9779_RS13040 | tasA | 2522251..2523036 (-) | 786 | WP_010328256.1 | biofilm matrix protein TasA | - |
| D9779_RS13045 | sipW | 2523099..2523671 (-) | 573 | WP_082246288.1 | signal peptidase I SipW | - |
| D9779_RS13050 | tapA | 2523655..2524419 (-) | 765 | WP_121642892.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9779_RS13055 | - | 2524688..2525014 (+) | 327 | WP_026014435.1 | YqzG/YhdC family protein | - |
| D9779_RS13060 | - | 2525058..2525237 (-) | 180 | WP_010328251.1 | YqzE family protein | - |
| D9779_RS13065 | comGG | 2525309..2525683 (-) | 375 | WP_121642893.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| D9779_RS13070 | comGF | 2525684..2526067 (-) | 384 | WP_121642894.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| D9779_RS13075 | comGE | 2526093..2526440 (-) | 348 | WP_121642895.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6646.67 Da Isoelectric Point: 8.6596
>NTDB_id=320863 D9779_RS13030 WP_010328257.1 2521624..2521797(+) (sinI) [Bacillus vallismortis strain Bac111]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTINPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTINPF
Nucleotide
Download Length: 174 bp
>NTDB_id=320863 D9779_RS13030 WP_010328257.1 2521624..2521797(+) (sinI) [Bacillus vallismortis strain Bac111]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTGATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCA
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTGATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCA
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
94.737 |
100 |
0.947 |