Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   D9779_RS13075 Genome accession   NZ_CP033052
Coordinates   2526093..2526440 (-) Length   115 a.a.
NCBI ID   WP_121642895.1    Uniprot ID   -
Organism   Bacillus vallismortis strain Bac111     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2521093..2531440
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9779_RS13030 sinI 2521624..2521797 (+) 174 WP_010328257.1 anti-repressor SinI Regulator
  D9779_RS13035 sinR 2521831..2522166 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D9779_RS13040 tasA 2522251..2523036 (-) 786 WP_010328256.1 biofilm matrix protein TasA -
  D9779_RS13045 sipW 2523099..2523671 (-) 573 WP_082246288.1 signal peptidase I SipW -
  D9779_RS13050 tapA 2523655..2524419 (-) 765 WP_121642892.1 amyloid fiber anchoring/assembly protein TapA -
  D9779_RS13055 - 2524688..2525014 (+) 327 WP_026014435.1 YqzG/YhdC family protein -
  D9779_RS13060 - 2525058..2525237 (-) 180 WP_010328251.1 YqzE family protein -
  D9779_RS13065 comGG 2525309..2525683 (-) 375 WP_121642893.1 competence type IV pilus minor pilin ComGG Machinery gene
  D9779_RS13070 comGF 2525684..2526067 (-) 384 WP_121642894.1 competence type IV pilus minor pilin ComGF Machinery gene
  D9779_RS13075 comGE 2526093..2526440 (-) 348 WP_121642895.1 competence type IV pilus minor pilin ComGE Machinery gene
  D9779_RS13080 comGD 2526424..2526852 (-) 429 WP_121642896.1 competence type IV pilus minor pilin ComGD Machinery gene
  D9779_RS13085 comGC 2526842..2527138 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  D9779_RS13090 comGB 2527152..2528189 (-) 1038 WP_121642897.1 competence type IV pilus assembly protein ComGB Machinery gene
  D9779_RS13095 comGA 2528176..2529246 (-) 1071 WP_121642898.1 competence protein ComGA Machinery gene
  D9779_RS13105 - 2529458..2529868 (-) 411 WP_121642899.1 CBS domain-containing protein -
  D9779_RS13110 - 2529933..2530886 (-) 954 WP_010328242.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13185.18 Da        Isoelectric Point: 4.8480

>NTDB_id=320867 D9779_RS13075 WP_121642895.1 2526093..2526440(-) (comGE) [Bacillus vallismortis strain Bac111]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWSKLIANEDIAKSREIGYQIMNESISEYIMTGEGTASKTVAKHNNIYALK
WEEEGDYQTVCISAAAYKEKPFCLSIMRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=320867 D9779_RS13075 WP_121642895.1 2526093..2526440(-) (comGE) [Bacillus vallismortis strain Bac111]
ATGTGGAGAGAAAATAAGGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTTTATTGCTGACAGT
CGTGCCCTTGTGGAGCAAACTGATAGCTAATGAAGATATAGCGAAATCACGAGAGATCGGGTATCAGATCATGAATGAAA
GCATAAGCGAATATATCATGACTGGTGAAGGAACTGCTTCAAAAACAGTTGCGAAACACAATAATATCTATGCGCTGAAG
TGGGAGGAGGAGGGGGATTATCAAACCGTATGCATCTCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGCATTAT
GCGAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

78.261

100

0.783

Multiple sequence alignment