Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   D4H18_RS07415 Genome accession   NZ_CP032912
Coordinates   1500216..1500329 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 13-A-EK8     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1495216..1505329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4H18_RS07395 - 1495885..1497297 (-) 1413 WP_139523280.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4H18_RS07400 comB10 1497367..1498503 (-) 1137 WP_139523282.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4H18_RS07405 comB9 1498496..1499482 (-) 987 WP_139523284.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4H18_RS07410 comB8 1499482..1500219 (-) 738 WP_139523286.1 virB8 family protein Machinery gene
  D4H18_RS07415 comB7 1500216..1500329 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4H18_RS07420 comB6 1500345..1501400 (-) 1056 WP_139523393.1 P-type conjugative transfer protein TrbL Machinery gene
  D4H18_RS07425 - 1501408..1502403 (-) 996 WP_139523394.1 PDZ domain-containing protein -
  D4H18_RS07430 - 1502403..1502696 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4H18_RS07435 panD 1502699..1503052 (-) 354 WP_000142226.1 aspartate 1-decarboxylase -
  D4H18_RS07440 - 1503042..1505267 (-) 2226 WP_139523288.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=320340 D4H18_RS07415 WP_001217873.1 1500216..1500329(-) (comB7) [Helicobacter pylori strain 13-A-EK8]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=320340 D4H18_RS07415 WP_001217873.1 1500216..1500329(-) (comB7) [Helicobacter pylori strain 13-A-EK8]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment