Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   D9C08_RS16730 Genome accession   NZ_CP032872
Coordinates   3120230..3120604 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis subsp. subtilis strain 2KL1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3115230..3125604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D9C08_RS16690 (D9C08_16690) yqhG 3115562..3116356 (+) 795 WP_014480249.1 YqhG family protein -
  D9C08_RS16695 (D9C08_16695) sinI 3116539..3116712 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D9C08_RS16700 (D9C08_16700) sinR 3116746..3117081 (+) 336 WP_121509422.1 transcriptional regulator SinR Regulator
  D9C08_RS16705 (D9C08_16705) tasA 3117174..3117959 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  D9C08_RS16710 (D9C08_16710) sipW 3118023..3118595 (-) 573 WP_003230181.1 signal peptidase I SipW -
  D9C08_RS16715 (D9C08_16715) tapA 3118579..3119340 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  D9C08_RS16720 (D9C08_16720) yqzG 3119612..3119938 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  D9C08_RS16725 (D9C08_16725) spoIITA 3119980..3120159 (-) 180 WP_014480252.1 YqzE family protein -
  D9C08_RS16730 (D9C08_16730) comGG 3120230..3120604 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D9C08_RS16735 (D9C08_16735) comGF 3120605..3120988 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  D9C08_RS16740 (D9C08_16740) comGE 3121014..3121361 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  D9C08_RS16745 (D9C08_16745) comGD 3121345..3121776 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  D9C08_RS16750 (D9C08_16750) comGC 3121766..3122062 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  D9C08_RS16755 (D9C08_16755) comGB 3122076..3123113 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  D9C08_RS16760 (D9C08_16760) comGA 3123100..3124170 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  D9C08_RS16765 (D9C08_16765) - 3124382..3124579 (-) 198 WP_014480259.1 CBS domain-containing protein -
  D9C08_RS16770 (D9C08_16770) corA 3124581..3125534 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=319936 D9C08_RS16730 WP_014480253.1 3120230..3120604(-) (comGG) [Bacillus subtilis subsp. subtilis strain 2KL1]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=319936 D9C08_RS16730 WP_014480253.1 3120230..3120604(-) (comGG) [Bacillus subtilis subsp. subtilis strain 2KL1]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment