Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D9C08_RS16695 | Genome accession | NZ_CP032872 |
| Coordinates | 3116539..3116712 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain 2KL1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3111539..3121712
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D9C08_RS16680 (D9C08_16680) | gcvT | 3112339..3113427 (-) | 1089 | WP_017696204.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D9C08_RS16685 (D9C08_16685) | hepAA | 3113868..3115541 (+) | 1674 | WP_038829735.1 | SNF2-related protein | - |
| D9C08_RS16690 (D9C08_16690) | yqhG | 3115562..3116356 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| D9C08_RS16695 (D9C08_16695) | sinI | 3116539..3116712 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D9C08_RS16700 (D9C08_16700) | sinR | 3116746..3117081 (+) | 336 | WP_121509422.1 | transcriptional regulator SinR | Regulator |
| D9C08_RS16705 (D9C08_16705) | tasA | 3117174..3117959 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| D9C08_RS16710 (D9C08_16710) | sipW | 3118023..3118595 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| D9C08_RS16715 (D9C08_16715) | tapA | 3118579..3119340 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D9C08_RS16720 (D9C08_16720) | yqzG | 3119612..3119938 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| D9C08_RS16725 (D9C08_16725) | spoIITA | 3119980..3120159 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D9C08_RS16730 (D9C08_16730) | comGG | 3120230..3120604 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D9C08_RS16735 (D9C08_16735) | comGF | 3120605..3120988 (-) | 384 | WP_029317913.1 | ComG operon protein ComGF | Machinery gene |
| D9C08_RS16740 (D9C08_16740) | comGE | 3121014..3121361 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=319934 D9C08_RS16695 WP_003230187.1 3116539..3116712(+) (sinI) [Bacillus subtilis subsp. subtilis strain 2KL1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=319934 D9C08_RS16695 WP_003230187.1 3116539..3116712(+) (sinI) [Bacillus subtilis subsp. subtilis strain 2KL1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |