Detailed information NTG0000643

Experimentally validated

Overview

• Name: recR
• Type: Machinery gene
• Locus tag: BSU_00210
• Genome accession: NC_000964
• Coordinates: 28867..29463 (+)
• Length: 198 a.a.
• NCBI ID: NP_387902.1
• Uniprot ID: P24277
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: homologous recombination Homologous recombination

Function

Inactivation of RecA or its accessory factors, RecF, RecO, RecR and RecX, drastically reduce survival of mature dormant spores to ultrahigh vacuum desiccation and ionizing radiation that induce single strand (ss) DNA nicks and double-strand breaks (DSBs).

Genomic Context

Location: 23867..34463

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_00160 (BSU00160)	sleL	23868..25151 (-)	1284	NP_387897.1	spore peptidoglycan N-acetylglucosaminidase	-
BSU_00170 (BSU00170)	yaaI	25221..25766 (-)	546	NP_387898.1	putative amidase (isochorismatase family)	-
BSU_00180 (BSU00180)	tadA	25852..26337 (+)	486	NP_387899.1	tRNA specific adenosine A34 deaminase	-
BSU_00190 (BSU00190)	dnaX	26814..28505 (+)	1692	NP_387900.2	DNA polymerase III subunit tau subunit	-
BSU_00200 (BSU00200)	ebfC	28529..28852 (+)	324	NP_387901.1	nucleoid associated protein	-
BSU_00210 (BSU00210)	recR	28867..29463 (+)	597	NP_387902.1	recA filament-DNA complex stabilisation factor	Machinery gene
BSU_00220 (BSU00220)	yaaL	29481..29705 (+)	225	NP_387903.1	hypothetical protein	-
BSU_00230 (BSU00230)	bofA	29772..30035 (+)	264	NP_387904.2	inhibitor of the pro-sigma(K) processing machinery	-

Sequence

Protein

• Length: 198 a.a.
• Molecular weight: 21974.53 Da
• Isoelectric Point: 5.3504

>NTDB_id=643 BSU_00210 NP_387902.1 28867..29463(+) (recR) [Bacillus subtilis subsp. subtilis str. 168]
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDKS
VICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPEDIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLL
KPSGIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREL

Nucleotide

• Length: 597 bp

>NTDB_id=643 BSU_00210 NP_387902.1 28867..29463(+) (recR) [Bacillus subtilis subsp. subtilis str. 168]
ATGCAATATCCTGAACCAATATCAAAGCTGATTGACAGCTTTATGAAATTGCCAGGGATCGGACCGAAAACAGCGGTTCG
TCTGGCTTTTTTTGTTCTAGGTATGAAAGAAGATGTAGTATTAGATTTTGCGAAAGCATTAGTAAATGCGAAACGCAACC
TGACATATTGTTCAGTTTGCGGGCATATTACAGATCAGGACCCTTGCTATATATGTGAAGATACGCGCAGGGATAAGTCT
GTTATCTGTGTTGTGCAAGACCCTAAAGACGTTATCGCTATGGAGAAAATGAAGGAATACAACGGACAGTATCACGTTCT
TCACGGCGCTATTTCTCCAATGGACGGCATCGGACCGGAGGATATTAAAATACCAGAATTGTTAAAACGATTACAGGATG
ATCAAGTGACAGAAGTGATCCTCGCGACAAACCCTAATATAGAAGGGGAAGCAACAGCGATGTATATATCAAGGCTCCTC
AAGCCGTCTGGTATTAAGCTCTCCCGTATTGCCCACGGACTGCCCGTCGGCGGTGATTTGGAATATGCTGATGAGGTCAC
TCTTTCTAAAGCACTTGAAGGAAGACGTGAATTGTAA

Domains

Predicted by InterProScan.

• RecR protein (RecR_ZnF) (40-78)

• Toprim domain (Toprim_4) (80-171)

3D structure

• AlphaFold DB: P24277

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
recR	Streptococcus pneumoniae R6	62.121	100	0.621
recR	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	52.041	98.99	0.515

References

• [1]: Ignacija Vlašić et al. (2014) Bacillus subtilis RecA and its accessory factors, RecF, RecO, RecR and RecX, are required for spore resistance to DNA double-strand break. Nucleic Acids Research 42(4):2295-307. [PMID: 24285298]
• [2]: Justin S Lenhart et al. (2014) RecO and RecR are necessary for RecA loading in response to DNA damage and replication fork stress. Journal of Bacteriology 196(15):2851-60. [PMID: 24891441]
• [3]: S Ayora et al. (1997) Bacillus subtilis 168 RecR protein-DNA complexes visualized as looped structures. Molecular & General Genetics : MGG 254(1):54-62. [PMID: 9108290]
• [4]: S Ayora et al. (1997) RecR is a zinc metalloprotein from Bacillus subtilis 168. Molecular Microbiology 23(4):639-47. [PMID: 9157236]
• [5]: J C Alonso et al. (1993) Purification and properties of the RecR protein from Bacillus subtilis 168. The Journal of Biological Chemistry 268(2):1424-9. [PMID: 8419343]