Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   D4L01_RS07615 Genome accession   NZ_CP032473
Coordinates   1553492..1553605 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 476-A2-EK2     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1548492..1558605
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D4L01_RS07595 - 1549170..1550582 (-) 1413 WP_139542477.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  D4L01_RS07600 comB10 1550652..1551782 (-) 1131 WP_139542478.1 DNA type IV secretion system protein ComB10 Machinery gene
  D4L01_RS07605 comB9 1551775..1552758 (-) 984 WP_139542479.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  D4L01_RS07610 comB8 1552758..1553495 (-) 738 WP_139542480.1 virB8 family protein Machinery gene
  D4L01_RS07615 comB7 1553492..1553605 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  D4L01_RS07620 comB6 1553621..1554676 (-) 1056 WP_139542588.1 P-type conjugative transfer protein TrbL Machinery gene
  D4L01_RS07625 - 1554684..1555679 (-) 996 WP_139542589.1 PDZ domain-containing protein -
  D4L01_RS07630 - 1555679..1555972 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  D4L01_RS07635 panD 1555975..1556328 (-) 354 WP_139542481.1 aspartate 1-decarboxylase -
  D4L01_RS07640 - 1556318..1558543 (-) 2226 WP_139542482.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=316177 D4L01_RS07615 WP_001217873.1 1553492..1553605(-) (comB7) [Helicobacter pylori strain 476-A2-EK2]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=316177 D4L01_RS07615 WP_001217873.1 1553492..1553605(-) (comB7) [Helicobacter pylori strain 476-A2-EK2]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1

Multiple sequence alignment