Detailed information NTG0312363

Bioinformatically predicted

Overview

• Name: comA
• Type: Regulator
• Locus tag: D1O36_RS10970
• Genome accession: NZ_CP031881
• Coordinates: 262410..262805 (+)
• Length: 131 a.a.
• NCBI ID: WP_252989162.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain ST106
• Function: processing and transport of ComC (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	263342..264518	262410..262805	flank	537

Gene organization within MGE regions

Location: 262410..264518

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D1O36_RS10970	comA	262410..262805 (+)	396	WP_252989162.1	ABC transporter transmembrane domain-containing protein	Regulator
D1O36_RS10975 (D1O36_01480)	comA	262889..263257 (+)	369	WP_255136094.1	ABC transporter transmembrane domain-containing protein	Regulator
D1O36_RS01485 (D1O36_01485)	-	263342..264518 (+)	1177	Protein_239	IS256-like element IS1191 family transposase	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 14792.58 Da
• Isoelectric Point: 7.1587

>NTDB_id=312363 D1O36_RS10970 WP_252989162.1 262410..262805(+) (comA) [Streptococcus thermophilus strain ST106]
MTLVNIIGSYYLQSIIDRLIPQEDYSLLIVISLGLCIAYLAQQVFTFFKDYLLHRLGNYLSISVILPYIKHVLSLPISFF
GSRRTGEITSRFRDANTIIDALASTILSIFLDVTIVITLAVALILQTVLFF

Nucleotide

• Length: 396 bp

>NTDB_id=312363 D1O36_RS10970 WP_252989162.1 262410..262805(+) (comA) [Streptococcus thermophilus strain ST106]
GTGACCCTTGTTAATATTATTGGTTCTTATTATTTGCAGTCTATTATAGACCGCTTGATTCCTCAAGAAGACTATTCTCT
TCTGATTGTGATTTCTCTCGGTTTGTGCATCGCCTATCTAGCCCAACAAGTCTTCACTTTTTTCAAAGATTATCTTCTAC
ATCGATTGGGTAATTACTTGTCCATTTCTGTTATCCTTCCTTATATTAAACATGTCCTTTCTTTGCCCATTAGTTTCTTC
GGTTCACGTCGTACTGGTGAAATCACGTCACGTTTTAGAGATGCCAACACCATTATCGATGCTCTAGCTTCAACAATCTT
ATCGATTTTCCTAGATGTCACCATTGTGATAACTTTAGCTGTCGCCCTTATTTTACAAACCGTTCTCTTTTTTTGA

Domains

Predicted by InterproScan.

• ABC transporter transmembrane region (ABC_membrane) (3-127)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comA	Streptococcus mitis NCTC 12261	61.364	100	0.618
comA	Streptococcus gordonii str. Challis substr. CH1	61.364	100	0.618
comA	Streptococcus pneumoniae Rx1	60.606	100	0.611
comA	Streptococcus pneumoniae D39	60.606	100	0.611
comA	Streptococcus pneumoniae TIGR4	60.606	100	0.611
comA	Streptococcus pneumoniae R6	60.606	100	0.611
comA	Streptococcus mitis SK321	60.606	100	0.611
comA/nlmT	Streptococcus mutans UA159	58.333	100	0.588