Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   D0808_RS14775 Genome accession   NZ_CP031783
Coordinates   2901646..2902020 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain MENO2 voucher National Research Centre     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2896646..2907020
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  D0808_RS14735 (D0808_14850) yqhG 2896976..2897770 (+) 795 WP_003230200.1 YqhG family protein -
  D0808_RS14740 (D0808_14855) sinI 2897953..2898126 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  D0808_RS14745 (D0808_14860) sinR 2898160..2898495 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  D0808_RS14750 (D0808_14865) tasA 2898588..2899373 (-) 786 WP_153256196.1 biofilm matrix protein TasA -
  D0808_RS14755 (D0808_14870) sipW 2899437..2900009 (-) 573 WP_003246088.1 signal peptidase I SipW -
  D0808_RS14760 (D0808_14875) tapA 2899993..2900754 (-) 762 WP_129092525.1 amyloid fiber anchoring/assembly protein TapA -
  D0808_RS14765 (D0808_14880) yqzG 2901027..2901353 (+) 327 WP_024573388.1 YqzG/YhdC family protein -
  D0808_RS14770 (D0808_14885) spoIITA 2901395..2901574 (-) 180 WP_014480252.1 YqzE family protein -
  D0808_RS14775 (D0808_14890) comGG 2901646..2902020 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  D0808_RS14780 (D0808_14895) comGF 2902021..2902404 (-) 384 WP_130572559.1 ComG operon protein ComGF Machinery gene
  D0808_RS14785 (D0808_14900) comGE 2902430..2902777 (-) 348 WP_153256197.1 ComG operon protein 5 Machinery gene
  D0808_RS14790 (D0808_14905) comGD 2902761..2903192 (-) 432 WP_153256198.1 comG operon protein ComGD Machinery gene
  D0808_RS14795 (D0808_14910) comGC 2903182..2903478 (-) 297 WP_129092527.1 comG operon protein ComGC Machinery gene
  D0808_RS14800 (D0808_14915) comGB 2903492..2904529 (-) 1038 WP_153256199.1 comG operon protein ComGB Machinery gene
  D0808_RS14805 (D0808_14920) comGA 2904516..2905586 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  D0808_RS14815 (D0808_14930) corA 2905982..2906935 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=311313 D0808_RS14775 WP_014480253.1 2901646..2902020(-) (comGG) [Bacillus subtilis strain MENO2 voucher National Research Centre]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=311313 D0808_RS14775 WP_014480253.1 2901646..2902020(-) (comGG) [Bacillus subtilis strain MENO2 voucher National Research Centre]
ATGTACCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAGCAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment