Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | D0808_RS14740 | Genome accession | NZ_CP031783 |
| Coordinates | 2897953..2898126 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis strain MENO2 voucher National Research Centre | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2892953..2903126
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D0808_RS14725 (D0808_14840) | gcvT | 2893752..2894840 (-) | 1089 | WP_086344077.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| D0808_RS14730 (D0808_14845) | hepAA | 2895282..2896955 (+) | 1674 | WP_047182869.1 | SNF2-related protein | - |
| D0808_RS14735 (D0808_14850) | yqhG | 2896976..2897770 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| D0808_RS14740 (D0808_14855) | sinI | 2897953..2898126 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| D0808_RS14745 (D0808_14860) | sinR | 2898160..2898495 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| D0808_RS14750 (D0808_14865) | tasA | 2898588..2899373 (-) | 786 | WP_153256196.1 | biofilm matrix protein TasA | - |
| D0808_RS14755 (D0808_14870) | sipW | 2899437..2900009 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| D0808_RS14760 (D0808_14875) | tapA | 2899993..2900754 (-) | 762 | WP_129092525.1 | amyloid fiber anchoring/assembly protein TapA | - |
| D0808_RS14765 (D0808_14880) | yqzG | 2901027..2901353 (+) | 327 | WP_024573388.1 | YqzG/YhdC family protein | - |
| D0808_RS14770 (D0808_14885) | spoIITA | 2901395..2901574 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| D0808_RS14775 (D0808_14890) | comGG | 2901646..2902020 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| D0808_RS14780 (D0808_14895) | comGF | 2902021..2902404 (-) | 384 | WP_130572559.1 | ComG operon protein ComGF | Machinery gene |
| D0808_RS14785 (D0808_14900) | comGE | 2902430..2902777 (-) | 348 | WP_153256197.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=311311 D0808_RS14740 WP_003230187.1 2897953..2898126(+) (sinI) [Bacillus subtilis strain MENO2 voucher National Research Centre]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=311311 D0808_RS14740 WP_003230187.1 2897953..2898126(+) (sinI) [Bacillus subtilis strain MENO2 voucher National Research Centre]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |