Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   DXY22_RS15480 Genome accession   NZ_CP031693
Coordinates   3045387..3045770 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM101393     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3040387..3050770
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY22_RS15440 (DXY22_03035) sinI 3041321..3041494 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DXY22_RS15445 (DXY22_03036) sinR 3041528..3041863 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DXY22_RS15450 (DXY22_03037) tasA 3041956..3042741 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  DXY22_RS15455 (DXY22_03038) sipW 3042805..3043377 (-) 573 WP_003246088.1 signal peptidase I SipW -
  DXY22_RS15460 (DXY22_03039) tapA 3043361..3044122 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  DXY22_RS15465 (DXY22_03040) yqzG 3044394..3044720 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DXY22_RS15470 (DXY22_03041) spoIITA 3044762..3044941 (-) 180 WP_029726723.1 YqzE family protein -
  DXY22_RS15475 (DXY22_03042) comGG 3045012..3045386 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  DXY22_RS15480 comGF 3045387..3045770 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  DXY22_RS15485 (DXY22_03044) comGE 3045796..3046143 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  DXY22_RS15490 (DXY22_03045) comGD 3046127..3046558 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  DXY22_RS15495 (DXY22_03046) comGC 3046548..3046844 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  DXY22_RS15500 (DXY22_03047) comGB 3046858..3047895 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  DXY22_RS15505 (DXY22_03048) comGA 3047882..3048952 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  DXY22_RS15510 (DXY22_03050) - 3049165..3049362 (-) 198 WP_014480259.1 CBS domain-containing protein -
  DXY22_RS15515 (DXY22_03051) corA 3049364..3050317 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=310339 DXY22_RS15480 WP_015251713.1 3045387..3045770(-) (comGF) [Bacillus subtilis strain SRCM101393]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=310339 DXY22_RS15480 WP_015251713.1 3045387..3045770(-) (comGF) [Bacillus subtilis strain SRCM101393]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment