Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   DXY22_RS15440 Genome accession   NZ_CP031693
Coordinates   3041321..3041494 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM101393     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3036321..3046494
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DXY22_RS15425 (DXY22_03032) gcvT 3037120..3038208 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  DXY22_RS15430 (DXY22_03033) hepAA 3038650..3040323 (+) 1674 WP_004398544.1 SNF2-related protein -
  DXY22_RS15435 (DXY22_03034) yqhG 3040344..3041138 (+) 795 WP_003230200.1 YqhG family protein -
  DXY22_RS15440 (DXY22_03035) sinI 3041321..3041494 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  DXY22_RS15445 (DXY22_03036) sinR 3041528..3041863 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DXY22_RS15450 (DXY22_03037) tasA 3041956..3042741 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  DXY22_RS15455 (DXY22_03038) sipW 3042805..3043377 (-) 573 WP_003246088.1 signal peptidase I SipW -
  DXY22_RS15460 (DXY22_03039) tapA 3043361..3044122 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  DXY22_RS15465 (DXY22_03040) yqzG 3044394..3044720 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  DXY22_RS15470 (DXY22_03041) spoIITA 3044762..3044941 (-) 180 WP_029726723.1 YqzE family protein -
  DXY22_RS15475 (DXY22_03042) comGG 3045012..3045386 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  DXY22_RS15480 comGF 3045387..3045770 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  DXY22_RS15485 (DXY22_03044) comGE 3045796..3046143 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=310336 DXY22_RS15440 WP_003230187.1 3041321..3041494(+) (sinI) [Bacillus subtilis strain SRCM101393]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=310336 DXY22_RS15440 WP_003230187.1 3041321..3041494(+) (sinI) [Bacillus subtilis strain SRCM101393]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment