Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | DV947_RS10015 | Genome accession | NZ_CP031545 |
| Coordinates | 269858..270067 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ST109 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 264858..275067
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DV947_RS01455 (DV947_01455) | - | 265296..265805 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| DV947_RS01460 (DV947_01460) | - | 266117..266674 (+) | 558 | WP_116920097.1 | ECF transporter S component | - |
| DV947_RS01465 (DV947_01465) | - | 266677..267327 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| DV947_RS01470 (DV947_01470) | comR | 267522..268421 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| DV947_RS10005 | - | 268659..269090 (+) | 432 | Protein_238 | cysteine peptidase family C39 domain-containing protein | - |
| DV947_RS10010 | - | 269120..269836 (+) | 717 | Protein_239 | ABC transporter transmembrane domain-containing protein | - |
| DV947_RS10015 (DV947_01485) | comA | 269858..270067 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| DV947_RS01495 (DV947_01495) | - | 270122..270690 (+) | 569 | Protein_241 | ATP-binding cassette domain-containing protein | - |
| DV947_RS01500 (DV947_01500) | - | 270798..271115 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| DV947_RS10020 | - | 271078..271362 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| DV947_RS10025 | - | 271602..272498 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| DV947_RS01510 (DV947_01510) | - | 272903..273418 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| DV947_RS01515 (DV947_01515) | - | 273443..273745 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| DV947_RS01520 (DV947_01520) | - | 273757..274068 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=307446 DV947_RS10015 WP_002946147.1 269858..270067(+) (comA) [Streptococcus thermophilus strain ST109]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=307446 DV947_RS10015 WP_002946147.1 269858..270067(+) (comA) [Streptococcus thermophilus strain ST109]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |