Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilX   Type   Machinery gene
Locus tag   DV155_RS01555 Genome accession   NZ_CP031326
Coordinates   279692..280165 (-) Length   157 a.a.
NCBI ID   WP_205254963.1    Uniprot ID   -
Organism   Neisseria meningitidis strain M21374     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 236600..284715 279692..280165 within 0


Gene organization within MGE regions


Location: 236600..284715
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DV155_RS01250 - 236894..237733 (-) 840 WP_002214477.1 hypothetical protein -
  DV155_RS01255 - 237774..238781 (+) 1008 WP_002220741.1 IS5 family transposase -
  DV155_RS14140 - 239197..239328 (+) 132 WP_002217434.1 hypothetical protein -
  DV155_RS01270 - 239325..239693 (+) 369 WP_002220735.1 type II toxin-antitoxin system death-on-curing family toxin -
  DV155_RS13655 - 239709..239879 (+) 171 WP_164728559.1 hypothetical protein -
  DV155_RS01275 - 240131..240622 (+) 492 WP_002217437.1 DUF4760 domain-containing protein -
  DV155_RS01280 - 240981..241217 (+) 237 WP_002217439.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  DV155_RS01285 - 241219..241566 (+) 348 WP_002219425.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DV155_RS01290 - 241619..242128 (-) 510 WP_002219426.1 hypothetical protein -
  DV155_RS01295 - 242140..242613 (-) 474 WP_002220733.1 D-Ala-D-Ala carboxypeptidase family metallohydrolase -
  DV155_RS01300 - 242752..243027 (-) 276 WP_002217443.1 hypothetical protein -
  DV155_RS01305 - 243024..243449 (-) 426 WP_002220721.1 hypothetical protein -
  DV155_RS01310 - 243513..243884 (-) 372 WP_002220720.1 hypothetical protein -
  DV155_RS14240 - 243952..244158 (-) 207 WP_002217448.1 hypothetical protein -
  DV155_RS01320 - 244175..244621 (-) 447 WP_002220718.1 hypothetical protein -
  DV155_RS01325 - 244692..248957 (-) 4266 WP_002220717.1 phage tail protein -
  DV155_RS01330 - 249093..249815 (-) 723 WP_002220716.1 tail assembly protein -
  DV155_RS01335 - 249812..250567 (-) 756 WP_002244525.1 C40 family peptidase -
  DV155_RS01340 - 250564..251286 (-) 723 WP_002217456.1 phage minor tail protein L -
  DV155_RS01345 - 251346..251615 (-) 270 WP_002217457.1 phage tail protein -
  DV155_RS01350 - 251637..254855 (-) 3219 WP_002224445.1 phage tail length tape measure family protein -
  DV155_RS01355 - 254848..255120 (-) 273 WP_002220710.1 DUF1799 domain-containing protein -
  DV155_RS01360 - 255168..255479 (-) 312 WP_002220709.1 phage tail assembly chaperone -
  DV155_RS01365 - 255543..256184 (-) 642 WP_002220708.1 phage tail protein -
  DV155_RS01370 - 256216..256635 (-) 420 WP_002244524.1 hypothetical protein -
  DV155_RS01375 - 256616..256918 (-) 303 WP_002244523.1 hypothetical protein -
  DV155_RS01380 - 256911..257138 (-) 228 WP_002220705.1 hypothetical protein -
  DV155_RS01385 - 257196..259088 (-) 1893 WP_002220704.1 phage major capsid protein -
  DV155_RS01390 - 259069..260631 (-) 1563 WP_002220703.1 phage portal protein -
  DV155_RS01395 - 260640..260894 (-) 255 WP_002220702.1 hypothetical protein -
  DV155_RS01400 - 260881..261267 (-) 387 WP_002220701.1 DUF3310 domain-containing protein -
  DV155_RS01405 - 261270..261479 (-) 210 WP_002220700.1 hypothetical protein -
  DV155_RS01410 - 261496..264342 (-) 2847 WP_002220699.1 primase-helicase family protein -
  DV155_RS01415 - 264457..264804 (-) 348 WP_002220698.1 hypothetical protein -
  DV155_RS01425 - 265204..265920 (+) 717 WP_002220696.1 helix-turn-helix transcriptional regulator -
  DV155_RS01430 - 266023..266448 (+) 426 WP_002220695.1 hypothetical protein -
  DV155_RS01435 - 266679..266879 (+) 201 WP_002219431.1 hypothetical protein -
  DV155_RS01440 - 266947..267306 (+) 360 WP_002220694.1 hypothetical protein -
  DV155_RS01445 - 267331..268185 (+) 855 WP_002220693.1 YfdQ family protein -
  DV155_RS01450 - 268257..268472 (+) 216 WP_002220692.1 hypothetical protein -
  DV155_RS01455 - 268508..268768 (+) 261 WP_002220690.1 hypothetical protein -
  DV155_RS01460 - 268765..269058 (+) 294 WP_002220689.1 hypothetical protein -
  DV155_RS01465 - 269061..269252 (+) 192 WP_002219435.1 type ISP restriction/modification enzyme -
  DV155_RS01470 - 269252..269392 (+) 141 WP_002220688.1 hypothetical protein -
  DV155_RS01475 - 269389..269598 (+) 210 WP_002220687.1 hypothetical protein -
  DV155_RS01480 - 269656..270573 (-) 918 WP_002220686.1 KilA-N domain-containing protein -
  DV155_RS01485 - 271439..271951 (-) 513 WP_002220685.1 DUF4760 domain-containing protein -
  DV155_RS01495 - 272354..272734 (-) 381 WP_002220683.1 type II toxin-antitoxin system PemK/MazF family toxin -
  DV155_RS01500 - 272889..274085 (-) 1197 WP_002224447.1 integrase arm-type DNA-binding domain-containing protein -
  DV155_RS01515 yaaA 274617..275396 (-) 780 WP_002220681.1 peroxide stress protein YaaA -
  DV155_RS01525 dapC 275658..276845 (-) 1188 WP_002220680.1 succinyldiaminopimelate transaminase -
  DV155_RS01530 dut 276921..277373 (-) 453 WP_002220679.1 dUTP diphosphatase -
  DV155_RS01535 - 277516..277941 (+) 426 Protein_260 AzlC family ABC transporter permease -
  DV155_RS01555 pilX 279692..280165 (-) 474 WP_205254963.1 PilX family type IV pilin Machinery gene
  DV155_RS01560 pilK 280170..280763 (-) 594 WP_115431786.1 pilus assembly protein Machinery gene
  DV155_RS01565 pilJ 280742..281689 (-) 948 WP_041423518.1 PilW family protein Machinery gene
  DV155_RS01570 pilV 281686..282309 (-) 624 WP_115431813.1 type IV pilus modification protein PilV Machinery gene
  DV155_RS01575 pilH 282342..283007 (-) 666 WP_101118812.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  DV155_RS01580 dnaB 283309..284715 (-) 1407 WP_002213843.1 replicative DNA helicase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17485.18 Da        Isoelectric Point: 9.1641

>NTDB_id=305672 DV155_RS01555 WP_205254963.1 279692..280165(-) (pilX) [Neisseria meningitidis strain M21374]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNISKQFILKNPLDDNETIKSKLEIFVSGYKM
NPKIAEKYNVSVHFVNKEKPRAYSLVGVPKTGTGYTLSVWMNSVGDGYKCRDAASARAYSETLSADAGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=305672 DV155_RS01555 WP_205254963.1 279692..280165(-) (pilX) [Neisseria meningitidis strain M21374]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTCGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATATTTCCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATGAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCGAAAAATATAATGTTTCGGTGCATTTTGTCAATAAGGAAAAACCAAGGGCATACAGCTTGGTCGG
CGTTCCAAAGACGGGGACGGGTTATACTTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCGAGCCTATTCGGAGACTTTATCCGCAGATGCCGGCTGCGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilX Neisseria meningitidis 8013

96.178

100

0.962
  pilL Neisseria gonorrhoeae MS11

87.261

100

0.873

Multiple sequence alignment