Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | DTA40_RS09780 | Genome accession | NZ_CP030928 |
| Coordinates | 262860..263069 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS18 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257860..268069
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DTA40_RS01430 (DTA40_01435) | - | 258299..258808 (+) | 510 | WP_024704182.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| DTA40_RS01435 (DTA40_01440) | - | 259119..259676 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| DTA40_RS01440 (DTA40_01445) | - | 259679..260329 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| DTA40_RS01445 (DTA40_01450) | comR | 260524..261423 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| DTA40_RS09675 | - | 261661..262092 (+) | 432 | Protein_235 | cysteine peptidase family C39 domain-containing protein | - |
| DTA40_RS09775 | - | 262122..262838 (+) | 717 | Protein_236 | ABC transporter transmembrane domain-containing protein | - |
| DTA40_RS09780 (DTA40_01465) | comA | 262860..263069 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| DTA40_RS01465 (DTA40_01475) | - | 263124..263692 (+) | 569 | Protein_238 | ATP-binding cassette domain-containing protein | - |
| DTA40_RS01470 (DTA40_01480) | - | 263800..264132 (+) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| DTA40_RS09785 | - | 264278..264757 (-) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| DTA40_RS09790 | - | 265199..265570 (-) | 372 | WP_224107488.1 | hypothetical protein | - |
| DTA40_RS01480 (DTA40_01500) | - | 265975..266490 (+) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| DTA40_RS01485 (DTA40_01505) | - | 266515..266817 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| DTA40_RS01490 (DTA40_01510) | - | 266829..267140 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=302455 DTA40_RS09780 WP_002946147.1 262860..263069(+) (comA) [Streptococcus thermophilus strain CS18]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=302455 DTA40_RS09780 WP_002946147.1 262860..263069(+) (comA) [Streptococcus thermophilus strain CS18]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |