Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | DR994_RS10035 | Genome accession | NZ_CP030927 |
| Coordinates | 1186585..1186794 (-) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS9 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1181585..1191794
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DR994_RS06095 (DR994_06265) | - | 1182584..1182895 (-) | 312 | WP_002886559.1 | urease subunit beta | - |
| DR994_RS06100 (DR994_06270) | - | 1182907..1183209 (-) | 303 | WP_002886558.1 | urease subunit gamma | - |
| DR994_RS06105 (DR994_06275) | - | 1183234..1183749 (-) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| DR994_RS10025 | - | 1184154..1185050 (+) | 897 | WP_224103642.1 | urease cluster protein | - |
| DR994_RS10340 | - | 1184975..1185322 (+) | 348 | WP_232089310.1 | DUF4173 domain-containing protein | - |
| DR994_RS10030 | - | 1185294..1185575 (+) | 282 | WP_232089302.1 | hypothetical protein | - |
| DR994_RS06115 (DR994_06285) | - | 1185543..1185854 (-) | 312 | WP_173940567.1 | DUF805 domain-containing protein | - |
| DR994_RS06120 (DR994_06290) | - | 1185962..1186530 (-) | 569 | Protein_1176 | ATP-binding cassette domain-containing protein | - |
| DR994_RS10035 (DR994_06300) | comA | 1186585..1186794 (-) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| DR994_RS06135 (DR994_06310) | - | 1186816..1188057 (-) | 1242 | Protein_1178 | ABC transporter transmembrane domain-containing protein | - |
| DR994_RS06145 (DR994_06315) | comR | 1188232..1189131 (-) | 900 | WP_002946143.1 | helix-turn-helix domain-containing protein | Regulator |
| DR994_RS06150 (DR994_06320) | - | 1189326..1189976 (-) | 651 | WP_022096567.1 | phosphatase PAP2 family protein | - |
| DR994_RS06155 (DR994_06325) | - | 1189979..1190536 (-) | 558 | WP_173940568.1 | ECF transporter S component | - |
| DR994_RS06160 (DR994_06330) | - | 1190847..1191356 (-) | 510 | WP_022096566.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=302394 DR994_RS10035 WP_002946147.1 1186585..1186794(-) (comA) [Streptococcus thermophilus strain CS9]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=302394 DR994_RS10035 WP_002946147.1 1186585..1186794(-) (comA) [Streptococcus thermophilus strain CS9]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |