Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   DKG78_RS12300 Genome accession   NZ_CP029466
Coordinates   2536798..2537175 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain HM618     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2531798..2542175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG78_RS12260 (DKG78_12455) - 2532295..2533089 (+) 795 WP_007612541.1 YqhG family protein -
  DKG78_RS12265 (DKG78_12460) sinI 2533266..2533439 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  DKG78_RS12270 (DKG78_12465) sinR 2533473..2533808 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DKG78_RS12275 (DKG78_12470) tasA 2533856..2534641 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  DKG78_RS12280 (DKG78_12475) sipW 2534706..2535290 (-) 585 WP_015240205.1 signal peptidase I SipW -
  DKG78_RS12285 (DKG78_12480) tapA 2535262..2535933 (-) 672 WP_069007150.1 amyloid fiber anchoring/assembly protein TapA -
  DKG78_RS12290 (DKG78_12485) - 2536192..2536521 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  DKG78_RS12295 (DKG78_12490) - 2536562..2536741 (-) 180 WP_003153093.1 YqzE family protein -
  DKG78_RS12300 (DKG78_12495) comGG 2536798..2537175 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  DKG78_RS12305 (DKG78_12500) comGF 2537176..2537676 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  DKG78_RS12310 (DKG78_12505) comGE 2537585..2537899 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  DKG78_RS12315 (DKG78_12510) comGD 2537883..2538320 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  DKG78_RS12320 (DKG78_12515) comGC 2538310..2538618 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  DKG78_RS12325 (DKG78_12520) comGB 2538623..2539660 (-) 1038 WP_059368114.1 competence type IV pilus assembly protein ComGB Machinery gene
  DKG78_RS12330 (DKG78_12525) comGA 2539647..2540717 (-) 1071 WP_132105381.1 competence type IV pilus ATPase ComGA Machinery gene
  DKG78_RS12335 (DKG78_12530) - 2540914..2541864 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=292816 DKG78_RS12300 WP_012117980.1 2536798..2537175(-) (comGG) [Bacillus amyloliquefaciens strain HM618]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=292816 DKG78_RS12300 WP_012117980.1 2536798..2537175(-) (comGG) [Bacillus amyloliquefaciens strain HM618]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment