Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DKG78_RS12265 | Genome accession | NZ_CP029466 |
| Coordinates | 2533266..2533439 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain HM618 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2528266..2538439
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DKG78_RS12250 (DKG78_12445) | gcvT | 2529079..2530179 (-) | 1101 | WP_132105373.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| DKG78_RS12255 (DKG78_12450) | - | 2530603..2532273 (+) | 1671 | WP_132105375.1 | DEAD/DEAH box helicase | - |
| DKG78_RS12260 (DKG78_12455) | - | 2532295..2533089 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| DKG78_RS12265 (DKG78_12460) | sinI | 2533266..2533439 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| DKG78_RS12270 (DKG78_12465) | sinR | 2533473..2533808 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DKG78_RS12275 (DKG78_12470) | tasA | 2533856..2534641 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| DKG78_RS12280 (DKG78_12475) | sipW | 2534706..2535290 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| DKG78_RS12285 (DKG78_12480) | tapA | 2535262..2535933 (-) | 672 | WP_069007150.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DKG78_RS12290 (DKG78_12485) | - | 2536192..2536521 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| DKG78_RS12295 (DKG78_12490) | - | 2536562..2536741 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| DKG78_RS12300 (DKG78_12495) | comGG | 2536798..2537175 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DKG78_RS12305 (DKG78_12500) | comGF | 2537176..2537676 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| DKG78_RS12310 (DKG78_12505) | comGE | 2537585..2537899 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| DKG78_RS12315 (DKG78_12510) | comGD | 2537883..2538320 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=292814 DKG78_RS12265 WP_003153105.1 2533266..2533439(+) (sinI) [Bacillus amyloliquefaciens strain HM618]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=292814 DKG78_RS12265 WP_003153105.1 2533266..2533439(+) (sinI) [Bacillus amyloliquefaciens strain HM618]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |