Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   DKG76_RS12955 Genome accession   NZ_CP029465
Coordinates   2637607..2637951 (-) Length   114 a.a.
NCBI ID   WP_003236954.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain KCTC 13429     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2632607..2642951
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG76_RS12910 (DKG76_12910) sinI 2633130..2633303 (+) 174 WP_003226347.1 anti-repressor SinI family protein Regulator
  DKG76_RS12915 (DKG76_12915) sinR 2633337..2633672 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DKG76_RS12920 (DKG76_12920) tasA 2633766..2634551 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  DKG76_RS12925 (DKG76_12925) - 2634615..2635187 (-) 573 WP_003236942.1 signal peptidase I -
  DKG76_RS12930 (DKG76_12930) tapA 2635171..2635935 (-) 765 WP_003236944.1 amyloid fiber anchoring/assembly protein TapA -
  DKG76_RS12935 (DKG76_12935) - 2636208..2636531 (+) 324 WP_003236947.1 YqzG/YhdC family protein -
  DKG76_RS12940 (DKG76_12940) - 2636573..2636752 (-) 180 WP_003236949.1 YqzE family protein -
  DKG76_RS12945 (DKG76_12945) comGG 2636823..2637197 (-) 375 WP_003236951.1 competence type IV pilus minor pilin ComGG Machinery gene
  DKG76_RS12950 (DKG76_12950) comGF 2637198..2637581 (-) 384 WP_032731882.1 competence type IV pilus minor pilin ComGF Machinery gene
  DKG76_RS12955 (DKG76_12955) comGE 2637607..2637951 (-) 345 WP_003236954.1 competence type IV pilus minor pilin ComGE Machinery gene
  DKG76_RS12960 (DKG76_12960) comGD 2637935..2638366 (-) 432 WP_003236956.1 competence type IV pilus minor pilin ComGD Machinery gene
  DKG76_RS12965 (DKG76_12965) comGC 2638356..2638652 (-) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  DKG76_RS12970 (DKG76_12970) comGB 2638666..2639703 (-) 1038 WP_003236959.1 competence type IV pilus assembly protein ComGB Machinery gene
  DKG76_RS12975 (DKG76_12975) comGA 2639690..2640760 (-) 1071 WP_003236962.1 competence protein ComGA Machinery gene
  DKG76_RS12980 (DKG76_12980) - 2640723..2640953 (-) 231 WP_032731884.1 hypothetical protein -
  DKG76_RS12985 (DKG76_12985) - 2640976..2641386 (-) 411 WP_003236965.1 CBS domain-containing protein -
  DKG76_RS12990 (DKG76_12990) corA 2641449..2642393 (-) 945 WP_003236968.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 114 a.a.        Molecular weight: 13215.25 Da        Isoelectric Point: 4.5188

>NTDB_id=292739 DKG76_RS12955 WP_003236954.1 2637607..2637951(-) (comGE) [Bacillus inaquosorum strain KCTC 13429]
MWRESKGFSTIETMSALSLWLFLMLTVVPLWDKLIADENMAESREIGYQLMNESISKYMMTGEGAASKTVTKNNNIYMLK
WEEEGEYQNVCISAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 345 bp        

>NTDB_id=292739 DKG76_RS12955 WP_003236954.1 2637607..2637951(-) (comGE) [Bacillus inaquosorum strain KCTC 13429]
ATGTGGAGAGAAAGTAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTCTGATGCTGACAGT
CGTTCCCTTGTGGGACAAGCTGATAGCTGATGAAAATATGGCGGAATCACGAGAAATCGGCTACCAGTTAATGAATGAAA
GTATTAGCAAATATATGATGACTGGTGAAGGAGCTGCGTCAAAAACGGTTACAAAGAACAATAATATCTATATGCTGAAG
TGGGAGGAGGAGGGAGAATATCAAAACGTATGCATCTCAGCAGCATATAAAGAAAAACCATTTTGCCTCAGCATTCTGCG
GACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

84.348

100

0.851


Multiple sequence alignment