Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   DKG76_RS12910 Genome accession   NZ_CP029465
Coordinates   2633130..2633303 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus inaquosorum strain KCTC 13429     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2628130..2638303
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DKG76_RS12895 (DKG76_12895) gcvT 2628925..2630013 (-) 1089 WP_003236933.1 glycine cleavage system aminomethyltransferase GcvT -
  DKG76_RS12900 (DKG76_12900) - 2630457..2632130 (+) 1674 WP_003236934.1 SNF2-related protein -
  DKG76_RS12905 (DKG76_12905) - 2632151..2632945 (+) 795 WP_003236936.1 YqhG family protein -
  DKG76_RS12910 (DKG76_12910) sinI 2633130..2633303 (+) 174 WP_003226347.1 anti-repressor SinI family protein Regulator
  DKG76_RS12915 (DKG76_12915) sinR 2633337..2633672 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  DKG76_RS12920 (DKG76_12920) tasA 2633766..2634551 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  DKG76_RS12925 (DKG76_12925) - 2634615..2635187 (-) 573 WP_003236942.1 signal peptidase I -
  DKG76_RS12930 (DKG76_12930) tapA 2635171..2635935 (-) 765 WP_003236944.1 amyloid fiber anchoring/assembly protein TapA -
  DKG76_RS12935 (DKG76_12935) - 2636208..2636531 (+) 324 WP_003236947.1 YqzG/YhdC family protein -
  DKG76_RS12940 (DKG76_12940) - 2636573..2636752 (-) 180 WP_003236949.1 YqzE family protein -
  DKG76_RS12945 (DKG76_12945) comGG 2636823..2637197 (-) 375 WP_003236951.1 competence type IV pilus minor pilin ComGG Machinery gene
  DKG76_RS12950 (DKG76_12950) comGF 2637198..2637581 (-) 384 WP_032731882.1 competence type IV pilus minor pilin ComGF Machinery gene
  DKG76_RS12955 (DKG76_12955) comGE 2637607..2637951 (-) 345 WP_003236954.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=292735 DKG76_RS12910 WP_003226347.1 2633130..2633303(+) (sinI) [Bacillus inaquosorum strain KCTC 13429]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=292735 DKG76_RS12910 WP_003226347.1 2633130..2633303(+) (sinI) [Bacillus inaquosorum strain KCTC 13429]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965

Multiple sequence alignment