Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | C1A39_RS09755 | Genome accession | NZ_CP028896 |
| Coordinates | 262937..263146 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CS5 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257937..268146
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1A39_RS01430 (C1A39_01435) | - | 258376..258885 (+) | 510 | WP_024704182.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| C1A39_RS01435 (C1A39_01440) | - | 259196..259753 (+) | 558 | WP_024704183.1 | ECF transporter S component | - |
| C1A39_RS01440 (C1A39_01445) | - | 259756..260406 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| C1A39_RS01445 (C1A39_01450) | comR | 260601..261500 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| C1A39_RS09660 | - | 261738..262169 (+) | 432 | Protein_235 | cysteine peptidase family C39 domain-containing protein | - |
| C1A39_RS09750 | - | 262199..262915 (+) | 717 | Protein_236 | ABC transporter transmembrane domain-containing protein | - |
| C1A39_RS09755 (C1A39_01465) | comA | 262937..263146 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| C1A39_RS01465 (C1A39_01475) | - | 263201..263769 (+) | 569 | Protein_238 | ATP-binding cassette domain-containing protein | - |
| C1A39_RS01470 (C1A39_01480) | - | 263877..264209 (+) | 333 | WP_024704184.1 | DUF805 domain-containing protein | - |
| C1A39_RS09760 | - | 264355..264834 (-) | 480 | WP_224107489.1 | DUF4153 domain-containing protein | - |
| C1A39_RS09765 | - | 265276..265647 (-) | 372 | WP_224107488.1 | hypothetical protein | - |
| C1A39_RS01480 (C1A39_01500) | - | 266052..266567 (+) | 516 | WP_024704185.1 | AmiS/UreI family transporter | - |
| C1A39_RS01485 (C1A39_01505) | - | 266592..266894 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| C1A39_RS01490 (C1A39_01510) | - | 266906..267217 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=288320 C1A39_RS09755 WP_002946147.1 262937..263146(+) (comA) [Streptococcus thermophilus strain CS5]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=288320 C1A39_RS09755 WP_002946147.1 262937..263146(+) (comA) [Streptococcus thermophilus strain CS5]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |