Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   DA377_RS08670 Genome accession   NZ_CP028439
Coordinates   1634633..1635010 (+) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus velezensis strain 8-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1629633..1640010
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA377_RS08635 - 1629949..1630899 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  DA377_RS08640 comGA 1631091..1632161 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DA377_RS08645 comGB 1632148..1633185 (+) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  DA377_RS08650 comGC 1633232..1633498 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DA377_RS08655 comGD 1633488..1633925 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA377_RS08660 comGE 1633909..1634223 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA377_RS08665 comGF 1634132..1634632 (+) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  DA377_RS08670 comGG 1634633..1635010 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA377_RS08675 - 1635067..1635246 (+) 180 WP_003153093.1 YqzE family protein -
  DA377_RS08680 - 1635286..1635615 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA377_RS08685 tapA 1635874..1636545 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA377_RS08690 sipW 1636517..1637101 (+) 585 WP_003153100.1 signal peptidase I SipW -
  DA377_RS08695 tasA 1637165..1637950 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA377_RS08700 sinR 1637998..1638333 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA377_RS08705 sinI 1638367..1638540 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  DA377_RS08710 - 1638717..1639511 (-) 795 WP_003153106.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=284932 DA377_RS08670 WP_003153092.1 1634633..1635010(+) (comGG) [Bacillus velezensis strain 8-2]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=284932 DA377_RS08670 WP_003153092.1 1634633..1635010(+) (comGG) [Bacillus velezensis strain 8-2]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment