Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   DA377_RS08650 Genome accession   NZ_CP028439
Coordinates   1633232..1633498 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain 8-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1628232..1638498
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA377_RS08630 - 1628502..1629803 (-) 1302 WP_003153081.1 hemolysin family protein -
  DA377_RS08635 - 1629949..1630899 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  DA377_RS08640 comGA 1631091..1632161 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  DA377_RS08645 comGB 1632148..1633185 (+) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  DA377_RS08650 comGC 1633232..1633498 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  DA377_RS08655 comGD 1633488..1633925 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA377_RS08660 comGE 1633909..1634223 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA377_RS08665 comGF 1634132..1634632 (+) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  DA377_RS08670 comGG 1634633..1635010 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA377_RS08675 - 1635067..1635246 (+) 180 WP_003153093.1 YqzE family protein -
  DA377_RS08680 - 1635286..1635615 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA377_RS08685 tapA 1635874..1636545 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA377_RS08690 sipW 1636517..1637101 (+) 585 WP_003153100.1 signal peptidase I SipW -
  DA377_RS08695 tasA 1637165..1637950 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA377_RS08700 sinR 1637998..1638333 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=284930 DA377_RS08650 WP_042635730.1 1633232..1633498(+) (comGC) [Bacillus velezensis strain 8-2]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=284930 DA377_RS08650 WP_042635730.1 1633232..1633498(+) (comGC) [Bacillus velezensis strain 8-2]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602

Multiple sequence alignment