Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   DA377_RS08705 Genome accession   NZ_CP028439
Coordinates   1638367..1638540 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 8-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1633367..1643540
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DA377_RS08655 comGD 1633488..1633925 (+) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene
  DA377_RS08660 comGE 1633909..1634223 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  DA377_RS08665 comGF 1634132..1634632 (+) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  DA377_RS08670 comGG 1634633..1635010 (+) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  DA377_RS08675 - 1635067..1635246 (+) 180 WP_003153093.1 YqzE family protein -
  DA377_RS08680 - 1635286..1635615 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  DA377_RS08685 tapA 1635874..1636545 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  DA377_RS08690 sipW 1636517..1637101 (+) 585 WP_003153100.1 signal peptidase I SipW -
  DA377_RS08695 tasA 1637165..1637950 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  DA377_RS08700 sinR 1637998..1638333 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  DA377_RS08705 sinI 1638367..1638540 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  DA377_RS08710 - 1638717..1639511 (-) 795 WP_003153106.1 YqhG family protein -
  DA377_RS08715 - 1639529..1641199 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  DA377_RS08720 gcvT 1641622..1642722 (+) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=284934 DA377_RS08705 WP_003153105.1 1638367..1638540(-) (sinI) [Bacillus velezensis strain 8-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=284934 DA377_RS08705 WP_003153105.1 1638367..1638540(-) (sinI) [Bacillus velezensis strain 8-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment