Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | DA377_RS08705 | Genome accession | NZ_CP028439 |
| Coordinates | 1638367..1638540 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 8-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1633367..1643540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DA377_RS08655 | comGD | 1633488..1633925 (+) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| DA377_RS08660 | comGE | 1633909..1634223 (+) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| DA377_RS08665 | comGF | 1634132..1634632 (+) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| DA377_RS08670 | comGG | 1634633..1635010 (+) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| DA377_RS08675 | - | 1635067..1635246 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| DA377_RS08680 | - | 1635286..1635615 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| DA377_RS08685 | tapA | 1635874..1636545 (+) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| DA377_RS08690 | sipW | 1636517..1637101 (+) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| DA377_RS08695 | tasA | 1637165..1637950 (+) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| DA377_RS08700 | sinR | 1637998..1638333 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| DA377_RS08705 | sinI | 1638367..1638540 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| DA377_RS08710 | - | 1638717..1639511 (-) | 795 | WP_003153106.1 | YqhG family protein | - |
| DA377_RS08715 | - | 1639529..1641199 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| DA377_RS08720 | gcvT | 1641622..1642722 (+) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=284934 DA377_RS08705 WP_003153105.1 1638367..1638540(-) (sinI) [Bacillus velezensis strain 8-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=284934 DA377_RS08705 WP_003153105.1 1638367..1638540(-) (sinI) [Bacillus velezensis strain 8-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |