Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LL14B4_RS11830 Genome accession   NZ_CP028160
Coordinates   2373845..2374129 (-) Length   94 a.a.
NCBI ID   WP_017865155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain 14B4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2368845..2379129
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL14B4_RS11800 (LL14B4_11790) - 2369285..2369662 (-) 378 WP_033900715.1 pyridoxamine 5'-phosphate oxidase family protein -
  LL14B4_RS11805 (LL14B4_11795) - 2369867..2370733 (+) 867 WP_033900713.1 RluA family pseudouridine synthase -
  LL14B4_RS11810 (LL14B4_11800) - 2370772..2371581 (-) 810 WP_033900712.1 metal ABC transporter permease -
  LL14B4_RS11815 (LL14B4_11805) - 2371574..2372311 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LL14B4_RS11820 (LL14B4_11810) - 2372488..2373330 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LL14B4_RS11825 (LL14B4_11815) - 2373327..2373764 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LL14B4_RS11830 (LL14B4_11820) comGG 2373845..2374129 (-) 285 WP_017865155.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL14B4_RS11835 (LL14B4_11825) comGF 2374168..2374614 (-) 447 WP_058203710.1 competence type IV pilus minor pilin ComGF Machinery gene
  LL14B4_RS11840 (LL14B4_11830) comGE 2374577..2374873 (-) 297 WP_033900709.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL14B4_RS11845 (LL14B4_11835) comGD 2374845..2375243 (-) 399 WP_233610962.1 competence type IV pilus minor pilin ComGD Machinery gene
  LL14B4_RS11850 (LL14B4_11840) comGC 2375236..2375619 (-) 384 WP_080735951.1 competence type IV pilus major pilin ComGC Machinery gene
  LL14B4_RS11855 (LL14B4_11845) comGB 2375633..2376706 (-) 1074 WP_080735950.1 competence type IV pilus assembly protein ComGB Machinery gene
  LL14B4_RS11860 (LL14B4_11850) comGA 2376600..2377538 (-) 939 WP_033900707.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10782.04 Da        Isoelectric Point: 5.5720

>NTDB_id=281827 LL14B4_RS11830 WP_017865155.1 2373845..2374129(-) (comGG) [Lactococcus lactis subsp. lactis strain 14B4]
MFSMFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=281827 LL14B4_RS11830 WP_017865155.1 2373845..2374129(-) (comGG) [Lactococcus lactis subsp. lactis strain 14B4]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGCAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

60.215

98.936

0.596

Multiple sequence alignment