Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DNO_RS03770 | Genome accession | NC_009446 |
| Coordinates | 816635..817090 (-) | Length | 151 a.a. |
| NCBI ID | WP_012031095.1 | Uniprot ID | A5EUY7 |
| Organism | Dichelobacter nodosus VCS1703A | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 786607..830921 | 816635..817090 | within | 0 |
Gene organization within MGE regions
Location: 786607..830921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DNO_RS03605 (DNO_0736) | rho | 786607..787872 (-) | 1266 | WP_012031065.1 | transcription termination factor Rho | - |
| DNO_RS03610 (DNO_0737) | trxA | 787971..788297 (-) | 327 | WP_012031066.1 | thioredoxin | - |
| DNO_RS06800 (DNO_0739) | - | 788865..789692 (+) | 828 | WP_012031068.1 | glycoside hydrolase family 108 protein | - |
| DNO_RS03620 (DNO_0740) | - | 789685..789960 (+) | 276 | WP_012031069.1 | hypothetical protein | - |
| DNO_RS03625 (DNO_0741) | - | 789947..790168 (+) | 222 | WP_148188634.1 | hypothetical protein | - |
| DNO_RS03630 (DNO_0742) | - | 790165..790956 (+) | 792 | WP_012031071.1 | hypothetical protein | - |
| DNO_RS03635 (DNO_0743) | - | 790934..792208 (+) | 1275 | WP_012031072.1 | PBSX family phage terminase large subunit | - |
| DNO_RS03640 | - | 792205..793098 (+) | 894 | WP_041729522.1 | DUF935 family protein | - |
| DNO_RS03645 | - | 793135..793662 (+) | 528 | WP_041729524.1 | hypothetical protein | - |
| DNO_RS06805 (DNO_0745) | - | 793659..795158 (+) | 1500 | WP_012031073.1 | phage head morphogenesis protein | - |
| DNO_RS03655 | - | 795155..795577 (+) | 423 | WP_041729526.1 | hypothetical protein | - |
| DNO_RS03660 (DNO_0746) | - | 795669..796067 (+) | 399 | WP_012031074.1 | DUF2190 family protein | - |
| DNO_RS03665 (DNO_0747) | - | 796078..796899 (+) | 822 | WP_012031075.1 | hypothetical protein | - |
| DNO_RS03670 (DNO_0748) | - | 796902..797888 (+) | 987 | WP_012031076.1 | major capsid protein | - |
| DNO_RS03675 (DNO_0749) | - | 797910..798377 (+) | 468 | WP_012031077.1 | gp436 family protein | - |
| DNO_RS06810 (DNO_0750) | - | 798374..798799 (+) | 426 | WP_012031078.1 | phage virion morphogenesis protein | - |
| DNO_RS03685 (DNO_0751) | - | 798780..799247 (+) | 468 | WP_012031079.1 | hypothetical protein | - |
| DNO_RS03690 (DNO_0752) | - | 799244..800011 (+) | 768 | WP_012031080.1 | hypothetical protein | - |
| DNO_RS03695 (DNO_0753) | - | 800014..800241 (+) | 228 | WP_012031081.1 | hypothetical protein | - |
| DNO_RS07045 (DNO_0754) | - | 800249..800458 (+) | 210 | WP_012031082.1 | hypothetical protein | - |
| DNO_RS06815 (DNO_0755) | - | 800495..804466 (+) | 3972 | WP_012031083.1 | phage tail tape measure protein | - |
| DNO_RS03710 (DNO_0756) | - | 804463..804867 (+) | 405 | WP_012031084.1 | hypothetical protein | - |
| DNO_RS03715 (DNO_0757) | - | 804876..808505 (+) | 3630 | WP_012031085.1 | hypothetical protein | - |
| DNO_RS03720 (DNO_0758) | - | 808507..809373 (+) | 867 | WP_012031086.1 | hypothetical protein | - |
| DNO_RS03725 (DNO_0759) | - | 809345..809710 (+) | 366 | WP_148188635.1 | hypothetical protein | - |
| DNO_RS03730 (DNO_0760) | - | 809797..811383 (+) | 1587 | WP_228369796.1 | hypothetical protein | - |
| DNO_RS03735 (DNO_0761) | - | 811392..811619 (+) | 228 | WP_012031089.1 | hypothetical protein | - |
| DNO_RS03740 | - | 811634..812068 (-) | 435 | WP_049752493.1 | hypothetical protein | - |
| DNO_RS03745 (DNO_0762) | - | 812055..812669 (-) | 615 | WP_041729532.1 | DNA methyltransferase | - |
| DNO_RS03750 (DNO_0763) | - | 812666..814279 (-) | 1614 | WP_012031091.1 | DEAD/DEAH box helicase | - |
| DNO_RS03755 (DNO_0764) | - | 814328..815422 (-) | 1095 | WP_012031092.1 | hypothetical protein | - |
| DNO_RS03760 (DNO_0765) | - | 815574..816242 (-) | 669 | WP_012031093.1 | hypothetical protein | - |
| DNO_RS03765 (DNO_0766) | - | 816363..816617 (-) | 255 | WP_012031094.1 | hypothetical protein | - |
| DNO_RS03770 (DNO_0767) | ssb | 816635..817090 (-) | 456 | WP_012031095.1 | single-stranded DNA-binding protein | Machinery gene |
| DNO_RS03775 (DNO_0768) | - | 817103..817960 (-) | 858 | WP_012031096.1 | YqaJ viral recombinase family protein | - |
| DNO_RS03780 (DNO_0769) | - | 817957..818562 (-) | 606 | WP_012031097.1 | ERF family protein | - |
| DNO_RS03785 (DNO_0770) | - | 818588..818920 (-) | 333 | WP_012031098.1 | hypothetical protein | - |
| DNO_RS03790 (DNO_0771) | - | 818920..819177 (-) | 258 | WP_148188636.1 | hypothetical protein | - |
| DNO_RS03795 (DNO_0772) | - | 819315..820709 (-) | 1395 | WP_152907698.1 | DUF4041 domain-containing protein | - |
| DNO_RS07200 | - | 820752..820874 (-) | 123 | WP_266105209.1 | hypothetical protein | - |
| DNO_RS03800 (DNO_0773) | - | 820877..821794 (-) | 918 | WP_012031101.1 | helix-turn-helix transcriptional regulator | - |
| DNO_RS06980 | - | 821941..822114 (+) | 174 | WP_081423590.1 | carph-isopro domain-containing protein | - |
| DNO_RS03805 (DNO_0774) | - | 822196..822459 (+) | 264 | WP_012031102.1 | helix-turn-helix domain-containing protein | - |
| DNO_RS06820 (DNO_0775) | - | 822460..823347 (+) | 888 | WP_012031103.1 | helix-turn-helix domain-containing protein | - |
| DNO_RS03815 (DNO_0776) | - | 823352..824116 (+) | 765 | WP_012031104.1 | ATP-binding protein | - |
| DNO_RS03825 | - | 824363..824878 (+) | 516 | WP_041729540.1 | hypothetical protein | - |
| DNO_RS06825 | - | 824871..825815 (+) | 945 | WP_049752494.1 | KilA-N domain-containing protein | - |
| DNO_RS03835 | - | 825812..826231 (+) | 420 | WP_041729542.1 | hypothetical protein | - |
| DNO_RS03840 (DNO_0780) | - | 826234..826611 (+) | 378 | WP_012031105.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DNO_RS03845 (DNO_0781) | - | 826605..826961 (+) | 357 | WP_012031106.1 | antiterminator Q family protein | - |
| DNO_RS07245 (DNO_0782) | - | 826961..827212 (+) | 252 | WP_012031107.1 | ABC-three component system middle component 8 | - |
| DNO_RS03855 (DNO_0783) | - | 827196..827603 (+) | 408 | WP_012031108.1 | hypothetical protein | - |
| DNO_RS03860 (DNO_0784) | - | 828101..829300 (-) | 1200 | WP_012031109.1 | site-specific integrase | - |
| DNO_RS03865 (DNO_0785) | - | 829442..830461 (+) | 1020 | WP_081423591.1 | MBL fold metallo-hydrolase | - |
| DNO_RS03870 (DNO_0786) | - | 830502..830921 (+) | 420 | WP_012031111.1 | OsmC family protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 17462.55 Da Isoelectric Point: 9.3185
>NTDB_id=28053 DNO_RS03770 WP_012031095.1 816635..817090(-) (ssb) [Dichelobacter nodosus VCS1703A]
MAGINKVILIGNVGKDPDMRVMTNGEQVANFSLATSMSWNDRQSGEKREKTEWHRCVAYRRIAEIIGQYVRKGSKLYIEG
RLETRKWQDQSGVERYTTEIIVNEMQMLGTVQSNNRAPQQKPQRKQNARNYANQYARESDGDDFVDDNVPF
MAGINKVILIGNVGKDPDMRVMTNGEQVANFSLATSMSWNDRQSGEKREKTEWHRCVAYRRIAEIIGQYVRKGSKLYIEG
RLETRKWQDQSGVERYTTEIIVNEMQMLGTVQSNNRAPQQKPQRKQNARNYANQYARESDGDDFVDDNVPF
Nucleotide
Download Length: 456 bp
>NTDB_id=28053 DNO_RS03770 WP_012031095.1 816635..817090(-) (ssb) [Dichelobacter nodosus VCS1703A]
ATGGCAGGCATCAATAAAGTAATTTTGATTGGCAATGTGGGGAAAGACCCTGATATGCGCGTGATGACCAACGGCGAGCA
AGTGGCAAATTTTTCATTGGCAACCAGCATGAGTTGGAACGACCGACAATCCGGCGAAAAACGCGAAAAAACAGAATGGC
ATCGTTGTGTTGCTTATCGGCGCATCGCGGAAATCATCGGGCAATACGTCAGAAAAGGCAGCAAATTATATATTGAAGGG
CGATTAGAAACGCGCAAATGGCAAGACCAAAGCGGCGTTGAGCGCTACACCACTGAAATCATCGTCAACGAAATGCAAAT
GCTGGGTACTGTGCAAAGCAACAATAGAGCACCGCAACAAAAACCGCAGCGCAAACAAAATGCGCGCAATTATGCGAATC
AATACGCGCGCGAAAGCGACGGCGACGATTTCGTCGACGACAATGTTCCGTTTTAA
ATGGCAGGCATCAATAAAGTAATTTTGATTGGCAATGTGGGGAAAGACCCTGATATGCGCGTGATGACCAACGGCGAGCA
AGTGGCAAATTTTTCATTGGCAACCAGCATGAGTTGGAACGACCGACAATCCGGCGAAAAACGCGAAAAAACAGAATGGC
ATCGTTGTGTTGCTTATCGGCGCATCGCGGAAATCATCGGGCAATACGTCAGAAAAGGCAGCAAATTATATATTGAAGGG
CGATTAGAAACGCGCAAATGGCAAGACCAAAGCGGCGTTGAGCGCTACACCACTGAAATCATCGTCAACGAAATGCAAAT
GCTGGGTACTGTGCAAAGCAACAATAGAGCACCGCAACAAAAACCGCAGCGCAAACAAAATGCGCGCAATTATGCGAATC
AATACGCGCGCGAAAGCGACGGCGACGATTTCGTCGACGACAATGTTCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
52.98 |
100 |
0.53 |
| ssb | Vibrio cholerae strain A1552 |
43.429 |
100 |
0.503 |
| ssb | Neisseria gonorrhoeae MS11 |
53.571 |
74.172 |
0.397 |
| ssb | Neisseria meningitidis MC58 |
53.571 |
74.172 |
0.397 |