Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | C4N11_RS11855 | Genome accession | NZ_CP026670 |
| Coordinates | 2218222..2218347 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain endophthalmitis isolate 335 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2213222..2223347
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C4N11_RS12740 | - | 2213561..2215163 (-) | 1603 | Protein_2189 | YhgE/Pip family protein | - |
| C4N11_RS11830 (C4N11_11830) | - | 2215342..2215884 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| C4N11_RS11845 (C4N11_11845) | comE | 2216127..2216879 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| C4N11_RS11850 (C4N11_11850) | comD/comD2 | 2216876..2218201 (-) | 1326 | WP_000364843.1 | competence system sensor histidine kinase ComD | Regulator |
| C4N11_RS11855 (C4N11_11855) | comC/comC2 | 2218222..2218347 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| C4N11_RS11865 (C4N11_11865) | rlmH | 2218629..2219108 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| C4N11_RS11870 (C4N11_11870) | htrA | 2219291..2220472 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| C4N11_RS11875 (C4N11_11875) | spo0J | 2220530..2221288 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=271480 C4N11_RS11855 WP_000799694.1 2218222..2218347(-) (comC/comC2) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=271480 C4N11_RS11855 WP_000799694.1 2218222..2218347(-) (comC/comC2) [Streptococcus pneumoniae strain endophthalmitis isolate 335]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |